Hi Jerry, The AlphaFold multimer capability is not in ChimeraX 1.3, it is in ChimeraX 1.4 daily builds. In ChimeraX 1.3 it only handles predicting single sequences so it is confused by your two sequences separated by a comma. Tom
On Dec 9, 2021, at 7:46 AM, Jerry Honts via ChimeraX-users <chimerax-users@cgl.ucsf.edu> wrote:
I am trying to use the AlphaFold predict multimer function in ChimeraX 1.3 with this syntax like (comma-separated pasted sequences):
alphafold predict MPEHPIQLASSNQVVSQILTTTQGSPTRQSKTFVYRSE,MSESPIRSSQYGKHVVNVSHIEKGQAPIYVSQSTVQNPIYVEKIVKVESSNT
But I keep getting an error:
Missing or invalid "sequence" argument: Sequences argument "MPEHPIQLASSNQVVSQILTTTQGSPTRQSKTFVYRSE,MSESPIRSSQYGKHVVNVSHIEKGQAPIYVSQSTVQNPIYVEKIVKVESSNT” is not a chain specifier, alignment id, UniProt id, or sequence characters
I think I am following the syntax given in the online help file, but can you suggest a reason for this error? Single chain predictions have been working fine with pasted sequences.
Thanks,
Jerry E. Honts Drake University _______________________________________________ ChimeraX-users mailing list ChimeraX-users@cgl.ucsf.edu Manage subscription: https://www.rbvi.ucsf.edu/mailman/listinfo/chimerax-users