The following bug report has been submitted: Platform: Darwin-19.3.0-x86_64-i386-64bit ChimeraX Version: 1.0 (2020-06-04 23:15:07 UTC) Description Hi, I'm trying to record a movie and the movie generated stops before executing all final steps. It's like the last frames are not recorded even when I see a very high limit. I feel like movie encode starts processing before it is called. For example these commands below are not present in the movie but the movie encode is called afterwards. # Select last interaction area select /F:370,375 /E:270,309,314 show sel atoms hbonds sel select clear # Final show turn x 15 60 rock 130 turn -y 15 60 rock 130 I'm a bit puzzled of why this is happening and I don't really now how to fix it. I attach the .cxc file with the set of instructions that I use to create the movie. Please consider that my experience level is beginner so there could be something that I'm doing wrong. Thank you! Nicco Log: UCSF ChimeraX version: 1.0 (2020-06-04) © 2016-2020 Regents of the University of California. All rights reserved. How to cite UCSF ChimeraX
open "/Users/niar/Dropbox (CRG ADV)/Nicco/projects/06_Chimera/src/movies/6NQ3_Suz12_AS_event.cxc"
open 6NQ3
6nq3 title: Crystal Structure of a SUZ12-RBBP4-PHF19-JARID2 Heterotetrameric Complex [more info...] Chain information for 6nq3 #1 --- Chain | Description A E | Histone-binding protein RBBP4 B F | Polycomb protein SUZ12 C G | PHD finger protein 19 D H | Protein Jumonji Non-standard residues in 6nq3 #1 --- ZN — zinc ion 6nq3 mmCIF Assemblies --- 1| software_defined_assembly 2| software_defined_assembly
select all
11928 atoms, 12213 bonds, 30 pseudobonds, 3 models selected
show sel cartoons
style sel stick
Changed 11928 atom styles
hide sel atoms
select /A,B,C,G,D,H
6565 atoms, 6720 bonds, 15 pseudobonds, 3 models selected
hide sel cartoons
select /E
3045 atoms, 3128 bonds, 2 pseudobonds, 2 models selected
color (#!1 & sel) purple
select /F
2318 atoms, 2365 bonds, 13 pseudobonds, 3 models selected
color (#!1 & sel) cyan
select clear
set bgColor white
lighting soft
graphics silhouettes true
view
view name start
movie record supersample 1 size 720,720 limit 5000 directory /Users/niar/Desktop/tmp_chimera pattern Frame_n*
turn z -70
turn x 24
turn y -40
view name hole
wait 5
select sequence EEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLP
1138 atoms, 1174 bonds, 1 model selected
color sel orange
select clear
wait 10
select sequence NHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYT
540 atoms, 552 bonds, 1 model selected
color sel spring green
select clear
wait 10
select sequence GHQKEGYGLSWNPNLSGHLLSASDDHTICLWD
500 atoms, 516 bonds, 1 model selected
color sel spring green
select clear
wait 10
select sequence GHTAVVEDVSWHLLHESLFGSVADDQKLMIWD
512 atoms, 526 bonds, 1 model selected
color sel spring green
select clear
wait 10
select sequence AHTAEVNCLSFNPYSEFILATGSADKTVALWD
488 atoms, 500 bonds, 1 model selected
color sel spring green
select clear
wait 10
select sequence SHKDEIFQVQWSPHNETILASSGTDRRLNVWD
532 atoms, 546 bonds, 1 model selected
color sel spring green
select clear
wait 10
select sequence GHTAKISDFSWNPNEPWVICSVSEDNIMQVWQ
522 atoms, 540 bonds, 1 model selected
color sel spring green
select clear
wait 10
select sequence RKTFKVDDMLSKVEKMKGEQESH
299 atoms, 299 bonds, 1 model selected
color sel red
select clear
wait 10
turn x 20 120 rock 120
wait
turn y 35 150 rock 150
wait
turn y 4 90
wait
turn y 1 50
wait
turn x 1 35
wait
zoom 1.5 80
wait
move x 0.75 15
move y -0.75 15
wait
view name side
select /E:9-28 /E:32-39
239 atoms, 242 bonds, 1 model selected
show sel atoms
hbonds sel
51 hydrogen bonds found
select clear
wait 20
turn x 15 60 rock 60
wait
turn y 15 60 rock 60
wait
~hbonds
select /E:9-28 /E:32-39
239 atoms, 242 bonds, 1 model selected
hide sel atoms
select clear
wait 5
move y 0.75 15
move x -0.75 15
wait
zoom 0.5 80
wait
turn -x 1 35
wait
turn -y 1 50
wait
view hole
move x 0.75 25
move y -0.5 25
wait 25
turn x 0.5 25
zoom 3 80
wait 80
turn x 0.75 25
move y 0.5 25
wait 25
view name zoom1
select /F:129 /E:409 /E:346
31 atoms, 29 bonds, 1 model selected
show sel atoms
color (#!1 & sel) byelement
hbonds sel
12 hydrogen bonds found
select clear
wait 15
turn -y 15 120 rock 120
wait
turn x 15 60 rock 130
wait
wait 15
view name zoom2
turn y -1.5 25
move x -0.5 25
wait 25
turn x -1 25
turn z 1 25
move x 0.4 25
wait 25
select /F:135 /E:285,304,330
34 atoms, 30 bonds, 1 model selected
show sel atoms
color (#!1 & sel) byelement
hbonds sel
11 hydrogen bonds found
select clear
turn y -10 120 rock 180
wait
turn x 15 120 rock 120
wait
wait 20
view name zoom3
zoom 0.5 50
turn -y 1 150
wait
move x 0.75 15
wait
turn x 1 20
wait
zoom 1.5 50
select /F:370,375 /E:270,309,314
42 atoms, 37 bonds, 1 model selected
show sel atoms
hbonds sel
8 hydrogen bonds found
select clear
turn x 15 60 rock 130
turn -y 15 60 rock 130
movie status
\-----Movie status------------------------------ Recording 1785 frames (in 'PPM' format) saved to directory '/Users/niar/Desktop/tmp_chimera' using pattern 'Frame_n*' . Est. movie length is 74.375s. \------------------------------------------------
movie encode /Users/niar/Desktop/Suz12_test1.mp4 format h264 quality low wait true verbose false
Movie saved to /Users/niar/Desktop/Suz12_test1.mp4 executed 6NQ3_Suz12_AS_event.cxc OpenGL version: 4.1 INTEL-14.4.23 OpenGL renderer: Intel(R) Iris(TM) Graphics 6100 OpenGL vendor: Intel Inc.Hardware: Hardware Overview: Model Name: MacBook Pro Model Identifier: MacBookPro12,1 Processor Name: Dual-Core Intel Core i5 Processor Speed: 2,7 GHz Number of Processors: 1 Total Number of Cores: 2 L2 Cache (per Core): 256 KB L3 Cache: 3 MB Hyper-Threading Technology: Enabled Memory: 8 GB Boot ROM Version: 189.0.0.0.0 SMC Version (system): 2.28f7 Software: System Software Overview: System Version: macOS 10.15.3 (19D76) Kernel Version: Darwin 19.3.0 Time since boot: 1 day 20:31 Graphics/Displays: Intel Iris Graphics 6100: Chipset Model: Intel Iris Graphics 6100 Type: GPU Bus: Built-In VRAM (Dynamic, Max): 1536 MB Vendor: Intel Device ID: 0x162b Revision ID: 0x0009 Metal: Supported, feature set macOS GPUFamily1 v4 Displays: Color LCD: Display Type: Built-In Retina LCD Resolution: 2560 x 1600 Retina Framebuffer Depth: 24-Bit Color (ARGB8888) Main Display: Yes Mirror: Off Online: Yes Automatically Adjust Brightness: No Connection Type: Internal HP LP2065: Resolution: 1600 x 1200 (UXGA - Ultra eXtended Graphics Array) UI Looks like: 1600 x 1200 @ 60 Hz Framebuffer Depth: 24-Bit Color (ARGB8888) Display Serial Number: CNG70302V3 Mirror: Off Online: Yes Rotation: Supported Automatically Adjust Brightness: No PyQt version: 5.12.3 Compiled Qt version: 5.12.4 Runtime Qt version: 5.12.8 File attachment: 6NQ3_Suz12_AS_event.cxc