[chimerax-users] alphafold predict multiuser syntax

I am trying to use the AlphaFold predict multimer function in ChimeraX 1.3 with this syntax like (comma-separated pasted sequences): alphafold predict MPEHPIQLASSNQVVSQILTTTQGSPTRQSKTFVYRSE,MSESPIRSSQYGKHVVNVSHIEKGQAPIYVSQSTVQNPIYVEKIVKVESSNT But I keep getting an error: Missing or invalid "sequence" argument: Sequences argument "MPEHPIQLASSNQVVSQILTTTQGSPTRQSKTFVYRSE,MSESPIRSSQYGKHVVNVSHIEKGQAPIYVSQSTVQNPIYVEKIVKVESSNT” is not a chain specifier, alignment id, UniProt id, or sequence characters I think I am following the syntax given in the online help file, but can you suggest a reason for this error? Single chain predictions have been working fine with pasted sequences. Thanks, Jerry E. Honts Drake University