- ChimeraX-users - RBVI Mailing Lists

Resizing an ion model representation
by Ioannis Skalidis 13 Jun '24

13 Jun '24

Dear all, I want to show a metal ion surrounded by some side-chains for a figure panel, but the ion ball representation is quite small and gets lost in the figure panel. Is there a way to select only the specific ion and increase its size? I tried a bit with the "size" command, including the ballScale option but I had no luck. Any suggestions? Thanks a lot, Ioannis. Dr. Ioannis Skalidis | Structural Biochemist | Twitter: @imjohnskal <https://twitter.com/imjohnskal>

2 1

Feature Request: Visual feedback on selecting menu items
by Cam McMenamie 12 Jun '24

12 Jun '24

Hello! I'm just suggesting a UI feature that I think would be very helpful. Currently, there are several menu items that do not show any feedback if they are "selected" or not, for example, in the screenshot below (hard to tell which options have been selected / toggled). This is especially the case for mutually exclusive selections such as in the 'coloring' section in the "molecule display" tab. [cid:34830b00-bed7-4734-b191-dc4fd0fad018] Thanks in advance, Cam

2 1

Filtering PAE Contacts–Interfaces
by David S. Fay 10 Jun '24

10 Jun '24

Hi, Was attempting (unsuccessfully) to filter out lower scoring (red/yellow) PAE contacts when viewing interaction interfaces between two or more proteins. I normally use a command such as: alphafold contacts /A to /B distance 5 But then I’d like to limit what I see to regions with high pLDDT scores (blue lines). I tried playing with range, but keep getting errors. Thanks! David

3 3

Animate RELION jobs
by James Hooker 10 Jun '24

10 Jun '24

Hi all, Is there an easy way to generate animations of RELION classification jobs in ChimeraX? I came across https://github.com/Stefan-Zukin/relionReport, but haven’t been able to get it to work. Best, James James Hooker jhooker(a)mrc-lmb.cam.ac.uk PhD candidate Löwe group, Structural Studies division MRC Lab of Molecular Biology Cambridge, United Kingdom

2 1

Re: [Chimera-users] ChimeraX_InfoRequest
by Elaine Meng 10 Jun '24

10 Jun '24

Hello Dr. Altan Kara, Resolution is just the number of pixels width and height. To get higher resolution, specify larger numbers for the pixel width and height in the save image options (GUI or save command). Chimera has a separate setting for physical size (e.g. inches or cm) and then the pixels per physical size unit (dpi), but the result is still the total number of pixels. For example 2 inches wide with 600 pixels/inch is 1200 pixels wide. ChimeraX does not have separate settings for the physical size. For the same example, in ChimeraX you would just choose 1200 pixels wide. The result will not be marked with a physical size, however. You would have to use some other program like Photoshop if you want to mark it as 2 inches wide. If you know the physical size you want and the resolution at that size, just calculate the total pixel width and height and enter that when you save the image. For the future, if you want to ask a ChimeraX question it is better to use the ChimeraX email address: chimerax-users(a)cgl.ucsf.edu I hope this helps, Elaine ----- Elaine C. Meng, Ph.D. UCSF Chimera(X) team Resource for Biocomputing, Visualization, and Informatics Department of Pharmaceutical Chemistry University of California, San Francisco > On Jun 7, 2024, at 5:17 AM, Altan KARA (MAM-GMBE) via Chimera-users <chimera-users(a)cgl.ucsf.edu> wrote: > > To whom it may concern, > > How we can create high resolution images with ChimeraX? > No matter what I tried still the outputted images are not in high resolution.

2 2

ChimeraX segfaults when left on loop to make movies/images
by Artie Kushner 07 Jun '24

07 Jun '24

Hi, I hope the summer is starting off really well for you. tldr: I leave ChimeraX running movie/image generating commands from a python script in a tmux session and it segfaults on multiple machines. I was wondering if someone has encountered this before or can lend advice as to why this happens. I'd like to produce some movies (or at least pictures) in bulk (around 2000 individual molecules). I preprocess each one (load locally or open, add some representation, and either start recording a movie or "save XXXX.png"). After about 8-10 successful movies or images are produced I get a ChimeraX segfault and the process dies. This is quite perplexing to me because - I tried it on multiple machines: Ubuntu 22.04, installed from the .deb <https://www.cgl.ucsf.edu/chimerax/download.html> and Arch, installed from aur distribution. - both with `--offscreen` and `--nogui` flags and without them ( in fact, following up some threads in the mailing list it seems like it's not possible to produce movies with --nogui, just pngs) - there seems to be *no* excessive memory or page cache issues, although i haven't profiled it. Only one core is occupied when rendering both mp4/png's. Below I'm attaching a crash log from one of the machines (Ubuntu 22.04) and the description of my setup, which is a little awkward, but I don't think it's the cause since it produces some samples successfully before crashing. I hope i'm wrong. Best regards and any tips are really appreciated! I was really looking forward to having some crisp images. --------------------------------------------------------------------------------------- I start the process by calling a python script at the command line: ` chimerax --script "/home/student/dev/riboxyz/chimerax/ribrepr.py" --nogui --offscreen` when i tried generated images. This was after I gave up on getting the movies, which i did by just opening a ChimeraX gui on our workstation and calling a "loop.py" after a load the commands from "ribrepr.py" file from the gui command line. I do both in a tmux session. ```loop.py import os from chimerax.core.commands import run from concurrent.futures import ThreadPoolExecutor *DEST_DIR* = "/home/rtviii/dev/riboxyz/chimerax/movies" # This expands to ~1800 PDB ids: rcsb_id:= {4UG0, 7K00 and so on} for rcsb_id in os.listdir('/home/rtviii/dev/RIBETL_DATA'): movie_dir = os.path.join(DEST_DIR, "{}.mp4".format(rcsb_id)) print("Attempting to write ", movie_dir) if "{}.mp4".format(rcsb_id) in os.listdir(DEST_DIR): print("Skipping {}. Exists".format(rcsb_id)) continue else: run(session,"ribmovie {}".format(rcsb_id)) # <---- ribmovie command corresponds to the `*produce_and_save_movie*` in ribrepr.py below ``` The contents of the `ribrepr.py` are just to register a command for custom visualization of a given molecule + loop over molecules for image generation. ``` ribrepr.py import enum import json import os import sys from chimerax.core.commands import register, CmdDesc from chimerax.atomic import ResiduesArg, Chains, ChainArg, StructureArg from chimerax.atomic import Structure, AtomicStructure, Chain from chimerax.core.commands import run, runscript from chimerax.core.commands import CmdDesc, register, StringArg # https://mail.cgl.ucsf.edu/mailman/archives/list/chimera-users@cgl.ucsf.edu/… # just a data folder, it exists. *RIBETL_DATA* = os.environ.get("RIBETL_DATA", "/home/rtviii/dev/RIBETL_DATA") class *PolymerClass*(str, enum.Enum): tRNA = "tRNA" bS1m = "bS1m" # ... another ~200 enum members, redacted for brevity CHIMERAX_COLORS = [ ["tan", "#d2b48c"], ["sienna", "#a0522d"], #... more colors redacted for brevity ] # helper function to map colors def *get_polymer_color*(polymer_class:str): polyix = list(map(lambda x: x.value, (PolymerClass))) class_index = polyix.index(polymer_class) % len(polyix) if polymer_class == None: return "gray" return CHIMERAX_COLORS[(class_index % len(CHIMERAX_COLORS))][1] def *ribosome_representation*(session, structure: AtomicStructure): for _ in list(PolymerClass): print(_.name) from chimerax.core.commands import run from chimerax.core.colors import hex_color from chimerax.atomic import Residue, Atom, Chain # i get the PDB ID from the StructureArg rcsb_id = str(structure.name).upper().split('.')[0] # <-- the structure gets opened with the basename ex "(5AFI.cif)" run(session, "set bgColor white") run(session, "sym #1 assembly 1") # take only one assembly if multiple are available run(session, "hide #2") with open(os.path.join(RIBETL_DATA, rcsb_id, "{}.json".format(rcsb_id)), "r") as f: profile = json.load(f) # load my annotations, just a json file #--------------------------------------------[ This whole bit just colors by chain annotation basically] polymers = {} polymer_chains = [ *profile["proteins"], *profile["rnas"], *profile["other_polymers"], ] [ polymers.update(x) for x in [{chain["auth_asym_id"]: chain} for chain in polymer_chains] ] c: Chain for c in structure.chains: aaid = c.chain_id polyclass = None if len(polymers[aaid]["nomenclature"]) < 1: continue else: polyclass = polymers[aaid]["nomenclature"][0] if polymers[aaid]["entity_poly_polymer_type"] == "RNA": run(session, "surf /{}".format(aaid)) run(session, "transp /{} 100".format(aaid)) run(session, "color /{} gray".format(aaid)) else: run(session, "show /{} cartoon".format(aaid, get_polymer_color(polyclass))) run(session, "color /{} {}".format(aaid, get_polymer_color(polyclass))) #--------------------------------------------[ This whole bit just colors by chain annotation basically] run(session, "graphics silhouettes true width 1") run(session, "light soft") # # ! Didn't work out for now. This is how i tried to make movies. (Loop over every structure (loop.py above) and call this command). Chimerax segfaults when looped on this. # def *produce_and_save_movie*(session, target:str): # print("GOT TARGET", target) # RCSB_ID = target # run(session, "open /home/rtviii/dev/RIBETL_DATA/{}/{}.cif".format(RCSB_ID, RCSB_ID)) # run(session, "sym #1 assembly 1") # take only one assembly if multiple are available # run(session, "ribrep #2") # run(session, "movie record") # run(session, "turn y 2 180") # run(session, "wait 180") # run(session, "movie encode /home/rtviii/dev/riboxyz/chimerax/movies/{}.mp4".format(RCSB_ID)) # run(session, "close all") # # ! This is just to not download the mmcif files i have locally. def *register_ribetl_command*(logger): def ribetl(session, rcsb_id:str): rcsb_id = rcsb_id.upper() run(session, "open /home/rtviii/dev/RIBETL_DATA/{}/{}.cif".format(rcsb_id, rcsb_id)) desc = CmdDesc( required= [("rcsb_id", StringArg)], ) register("ribetl", desc, ribetl, logger=logger) # # ! Register the above repr sequence as a command. def *register_ribrepr_command*(logger): from chimerax.core.commands import CmdDesc, register from chimerax.atomic import AtomicStructureArg, Chain, Residue, Atom desc = CmdDesc( required = [("structure", AtomicStructureArg)], required_arguments = ["structure"], synopsis = "representation ", ) register("ribrep", desc, ribosome_representation, logger=logger) *register_ribrepr_command*(session.logger) *register_ribetl_command*(session.logger) # This loop expands into a list of ~1800 PDB : 5AFI, 4UG0 and so on. for rcsb_id in os.listdir(RIBETL_DATA): run(session,"open {}".format(rcsb_id)) run(session,"ribrep #1") run(session,"save /home/student/dev/riboxyz/chimerax/{}.png width 800 height 800 transparentBackgroun d true".format(rcsb_id)) run(session,"close all") ``` Let me know if i can elucidate this situation further with hardware specs or whatnot. I'm quite at loss as to how to proceed with this.

2 2

Alpha fold not responding
by Cao,JingJing 07 Jun '24

07 Jun '24

Hello, I was using the program to run Alphafold prediction, it’s keep giving me error messages (502): The server encountered a temporary error and could not complete your request. Please try again in 30 seconds. That’s all we know. How to solve this problem? Thanks, JingJing The information contained in this e-mail message may be privileged, confidential, and/or protected from disclosure. This e-mail message may contain protected health information (PHI); dissemination of PHI should comply with applicable federal and state laws. If you are not the intended recipient, or an authorized representative of the intended recipient, any further review, disclosure, use, dissemination, distribution, or copying of this message or any attachment (or the information contained therein) is strictly prohibited. If you think that you have received this e-mail message in error, please notify the sender by return e-mail and delete all references to it and its contents from your systems.

2 1

Modifying the transparency of a specific region within a single map
by 张楠 07 Jun '24

07 Jun '24

Dear developers, How can I change the transparency of a specific region within a single map, similar to what is shown in the attached image? Is this possible to do in ChimeraX?" Looking forward to your answer, thank you！ Best regards, Nan zhangnan(a)nankai.edu.cn

3 2

Renaming of "Non-standard residues" upon file opening
by Mikkel Dahl Andreasen 07 Jun '24

07 Jun '24

Hello I have a question regarding ChimeraX renaming residues upon loading pdb files. I am specifically referring to a pdb file containing the following lines: TITLE PLACEHOLDER_TITLE REMARK PLACEHOLDER_REMARK CRYST1 100.000 100.000 100.000 90.00 90.00 90.00 P 1 1 MODEL 1 ATOM 1 NC3 DOPCA 1 93.725 50.146 69.265 1.00 0.00 ATOM 2 PO4 DOPCA 1 93.471 50.284 66.361 1.00 0.00 ATOM 3 GL1 DOPCA 1 93.591 50.038 63.469 1.00 0.00 ATOM 4 GL2 DOPCA 1 94.818 50.396 63.498 1.00 0.00 ATOM 5 C1A DOPCA 1 93.669 50.374 60.367 1.00 0.00 ATOM 6 D2A DOPCA 1 93.738 49.939 57.365 1.00 0.00 ATOM 7 C3A DOPCA 1 93.390 49.936 54.359 1.00 0.00 ATOM 8 C4A DOPCA 1 93.358 50.194 51.480 1.00 0.00 ATOM 9 C1B DOPCA 1 96.261 50.393 60.395 1.00 0.00 ATOM 10 D2B DOPCA 1 96.060 50.114 57.261 1.00 0.00 ATOM 11 C3B DOPCA 1 96.224 50.032 54.669 1.00 0.00 ATOM 12 C4B DOPCA 1 95.844 50.135 51.528 1.00 0.00 TER END When I load this file into ChimeraX using "open file.pdb" it renames the residue name "DOPC" to "DOP". A table appears in the Log regarding "Non-standard residues in file.pdb" wherein it lists "DOP - (DOP)" without mentioning "DOPC". However, when I open another file which contains many different types of molecules, then it does not rename "DOPC" to "DOP", even though the "Non-standard residues in file.pdb" table also appears, though this time with an entry containing "DOPC - (DOPC)". I have also previously experienced that ChimeraX renames some (not all) of my cholesterol molecules to "CHO" (instead of using the actual residue name which is "CHOL"). I had a look through the documentation for the "open" command, but I couldn't find anything useful about it. I was wondering why this is happening and if there is a way to prevent it. And just so i am clear, by prevent I don't mean revert (e.g. rename them back to "DOPC" after loading), but actually preventing the initial renaming done by ChimeraX. Kind regards, Mikkel Dahl Andreasen

3 3

modeller fails in chimerax RC-1.8
by Roberto Marabini 07 Jun '24

07 Jun '24

Hi, I just installed chimerax RC-1.8 and tried to use "modeller" (tools->sequence->modeller comparative). The resulting error message is attached to this email. If I use chimerax 1.7 with the very same data modeller works. Am I doing something wrong or did I find a bug? cheers Roberto Follows the complete log: === modeller comparative aligned_1.fasta:2 numModels 5 fast false multichain false hetPreserve true hydrogens false waterPreserve falseWebservices job id: GN1G33GHX39IPCAE Modeller job (ID GN1G33GHX39IPCAE) finished Modeller error output Traceback (most recent call last): File "ModellerModelling.py", line 74, in <module> a.make() File "/usr/lib64/python3.8/site-packages/modeller/automodel/automodel.py", line 141, in make self.homcsr(exit_stage) File "/usr/lib64/python3.8/site-packages/modeller/automodel/automodel.py", line 624, in homcsr self.check_alignment(aln) File "/usr/lib64/python3.8/site-packages/modeller/automodel/automodel.py", line 577, in check_alignment aln.check() File "/usr/lib64/python3.8/site-packages/modeller/alignment.py", line 213, in check self.check_structure_structure(io=io) File "/usr/lib64/python3.8/site-packages/modeller/alignment.py", line 222, in check_structure_structure return f(self.modpt, io.modpt, self.env.libs.modpt, eqvdst) _modeller.SequenceMismatchError: read_te_291E> Sequence difference between alignment and pdb : Modeller run output MODELLER 10.5, 2024/01/19, r12711 PROTEIN STRUCTURE MODELLING BY SATISFACTION OF SPATIAL RESTRAINTS Copyright(c) 1989-2024 Andrej Sali All Rights Reserved Written by A. Sali with help from B. Webb, M.S. Madhusudhan, M-Y. Shen, G.Q. Dong, M.A. Marti-Renom, N. Eswar, F. Alber, M. Topf, B. Oliva, A. Fiser, R. Sanchez, B. Yerkovich, A. Badretdinov, F. Melo, J.P. Overington, E. Feyfant University of California, San Francisco, USA Rockefeller University, New York, USA Harvard University, Cambridge, USA Imperial Cancer Research Fund, London, UK Birkbeck College, University of London, London, UK Kind, OS, HostName, Kernel, Processor: 4, Linux wilkins.cgl.ucsf.edu 4.18.0-513.24.1.el8_9.x86_64 x86_64 Date and time of compilation : 2024/01/20 00:40:16 MODELLER executable type : x86_64-intel8 Job starting time (YY/MM/DD HH:MM:SS): 2024/06/06 03:33:20 environ____W> The class 'environ' is deprecated; use 'Environ' instead openf___224_> Open $(LIB)/restyp.lib openf___224_> Open ${MODINSTALL10v5}/modlib/resgrp.lib rdresgr_266_> Number of residue groups: 2 openf___224_> Open ${MODINSTALL10v5}/modlib/sstruc.lib Dynamically allocated memory at amaxlibraries [B,KiB,MiB]: 191566 187.076 0.183 Dynamically allocated memory at amaxlibraries [B,KiB,MiB]: 192094 187.592 0.183 openf___224_> Open ${MODINSTALL10v5}/modlib/resdih.lib Dynamically allocated memory at amaxlibraries [B,KiB,MiB]: 240694 235.053 0.230 rdrdih__263_> Number of dihedral angle types : 9 Maximal number of dihedral angle optima: 3 Dihedral angle names : Alph Phi Psi Omeg chi1 chi2 chi3 chi4 chi5 openf___224_> Open ${MODINSTALL10v5}/modlib/radii.lib Dynamically allocated memory at amaxlibraries [B,KiB,MiB]: 253994 248.041 0.242 openf___224_> Open ${MODINSTALL10v5}/modlib/af_mnchdef.lib rdwilmo_274_> Mainchain residue conformation classes: APBLE openf___224_> Open ${MODINSTALL10v5}/modlib/mnch.lib rdclass_257_> Number of classes: 5 openf___224_> Open ${MODINSTALL10v5}/modlib/mnch1.lib openf___224_> Open ${MODINSTALL10v5}/modlib/mnch2.lib openf___224_> Open ${MODINSTALL10v5}/modlib/mnch3.lib openf___224_> Open ${MODINSTALL10v5}/modlib/xs4.mat rdrrwgh_268_> Number of residue types: 21 automodel__W> The class 'automodel' is deprecated; use 'AutoModel' instead openf___224_> Open alignment.ali Dynamically allocated memory at amaxalignment [B,KiB,MiB]: 282425 275.806 0.269 Dynamically allocated memory at amaxalignment [B,KiB,MiB]: 297517 290.544 0.284 Dynamically allocated memory at amaxalignment [B,KiB,MiB]: 312917 305.583 0.298 Dynamically allocated memory at amaxalignment [B,KiB,MiB]: 343717 335.661 0.328 Dynamically allocated memory at amaxsequence [B,KiB,MiB]: 344285 336.216 0.328 read_te_291E> Sequence difference between alignment and pdb : x (mismatch at alignment position 1) Alignment XSLSDKDKAAVRALWSKIGKSADAIGNDALSRMIVVYPQTKTYFSHWPDVTPGSP PDB SLSDKDKAAVRALWSKIGKSADAIGNDALSRMIVVYPQTKTYFSHWPDVTPGSPH Match * * Alignment residue type 24 (X, UNK) does not match pdb residue type 16 (S, SER), for align code 1pbx.cif_2/A (atom file 1pbx.cif_2), pdb residue number " 1", chain "A" Please check your alignment file header to be sure you correctly specified the starting and ending residue numbers and chains. The alignment sequence must match that from the atom file exactly. Another possibility is that some residues in the atom file are missing, perhaps because they could not be resolved experimentally. (Note that Modeller reads only the ATOM and HETATM records in PDB, NOT the SEQRES records.) In this case, simply replace the section of your alignment corresponding to these missing residues with gaps. read_te_288W> Protein not accepted: 1 1pbx.cif_2/A No output models from Modeller; see log for Modeller text output.

3 3

Converting a carbonyl group to carboxylic acid group
by Prathvi Singh 06 Jun '24

06 Jun '24

Hi Elaine, I have a SER residue which is in the middle of a polypeptide chain. Is there a way in chimera/chimeraX to specifically extract this residue such that the carbonyl group bonded to its N-terminal NH group also gets extracted but is converted to carboxylic acid group (-COOH group) before extracting? Thanks in advance, Prathvi Singh, Research Fellow, Department of Biological Sciences & Bioengineering, Indian Institute of Technology, Kanpur-208016

2 4

Molecule_to_sphere
by Noriega, Heather 06 Jun '24

06 Jun '24

Hello, I hope this email finds you well. I have a molecule that I created through the build feature in Chimera, and what I would like to do is just create a sphere of as many copies as it can fit to see the estimated encapsulation volume. However, there is no symmetry assembly to use the matchmaker and I was trying to use the sym command, but it isn't even recognizing the command. sym #1 i,222 sym #1 i, n25 Sym#1 i, 222r I have tried others with the center command, and I also tried to add copies false NewModel true at the end. What am I plugging in wrong? The molecule is saved as a pdb, and uploads no issue on ChimeraX. Thank you, Heather Noriega PhD-Pharmaceutical Science student Howard University heather.noriega(a)bison.howard.edu 520-203-1883

2 4

Push and pulling model/map towards/away
by Pranav Shah 05 Jun '24

05 Jun '24

Hi Team, Chimera used to have a really nice feature that allowed for a model to be pushed away or pulled towards the user. How do I access this feature in ChimeraX? Best, Pranav -- Pranav Shah Postdoctoral Research Fellow. Division of Structural Biology, Wellcome Trust Centre for Human Genetics, University of Oxford, Roosevelt Drive, Oxford OX3 7BN, UK

3 8

Selecting the N or C-terminus of every chain in a PDB file
by André Graça 05 Jun '24

05 Jun '24

Hi everyone! I could not figure this one out just yet, but it might be easy (?): I am interested to make a quick selection that targets the first or last atom of all the chains present in a given PDB file. /André Graça

2 1

Fetch many pdbs/maps from the pdb-redo?
by Francisco Murphy Pérez 05 Jun '24

05 Jun '24

Dear all I thought this was going to work, `open "1iee, 2blx, 2bly" fromDatabase redo format mmcif`... but it does not. I have many more ids that I want to open... Can I fetch them all with a single command? Thanks

2 2

Morph command for protein-ligand complexes
by Enrico Martinez 05 Jun '24

05 Jun '24

Dear ChimeraX users! I have a question about recording movie with the transitions between different conformations using morph command. Having five conformations for the same protein, after its supermpostiion using mm #2-5 to #1 I generated a trajectory with the transition using: morph #2,3,4,5,6 core 0.1 frames 100 wrap f rate linear And then recorded movie using: # start recording movie record size 3840,2160 supersample 1 coordset #7 1,400,1 computeSs true wait 400 My question is about morph command. Assuming that all 5 models are very well superimposed and the difference is only the bound ligand (which is different in every model!), would it be possible to include these different ligands in the final morphed trajectory, thus making a smooth transition between different binding poses ? Many thanks in advance ! Enrico

2 2

How to reproduce the output of "info" in python script?
by Artie Kushner 04 Jun '24

04 Jun '24

Hi there, hope you are all doing well I'm wondering if anyone has a good idea of how to reproduce the output of the *info* command in the GUI inside a python script. Precisely the *info* command without any specifiers s.t. that all models and submodels are listed with minimal info. Like the following: *...#1.87, 4v6x Cu, shown419 atoms, 421 bonds, 56 residues, 1 chains (Cu)#1.88, 4v6x Cv, shown419 atoms, 421 bonds, 56 residues, 1 chains (Cv)#1.89, 4v6x Cz, shown1741 atoms, 1769 bonds, 217 residues, 1 chains (Cz)* Perhaps there is a better way to do this, but my use case is splitting a bigger structure into multiple chains (as you can tell from above there are 89 chains in 4V6X). I'd like to be able to correlate chain IDs (ex. *Cz*) with the model identifiers (ex. *#1.89*) programmatically from within python to script against individual chains further. I'm sure there is more than one way to do it, but i haven't been able to find either so far. Most that i found is the model_info command: *from chimerax.list_info.util import spec, model_info...def test_func(session, structure: AtomicStructure): print(model_info(structure))**<<<Missing or invalid "structure" argument: must specify 1 atomic structure, got 89 for "#1".* *def register_ribrepr_command(logger): from chimerax.core.commands import CmdDesc, register from chimerax.atomic import AtomicStructureArg, Chain, Residue, Atom desc = CmdDesc( required = [("structure", AtomicStructureArg)], required_arguments = ["structure"], synopsis = "representation ", ) register("test_func", desc, test_func, logger=logger)* but it presupposes that I pass the model by spec I pass the "top-level" structure. It throws error saying that it contains 89 instead of 1 structures: *Missing or invalid "structure" argument: must specify 1 atomic structure, got 89 for "#1".* Any other way of getting at the correspondence dict between chains/"submodels" created with i.e. *`split chains`* and their chain_id's (aka *auth_asym_id* 's) in Python space would work for me. Perhaps there is a way to list all objects in the "Models" section (picture below)? Thanks in advance Artie [image: image.png]

2 2

Question/ GPCR complex
by Ranti Dev Shukla 03 Jun '24

03 Jun '24

Hello, Greetings from NIH, Maryland. I am trying to make FRET for G-proteins. I put CFP protein within G.alfa2 on a loop between two nearby helixes and YFP protein on the N-terminal of G-beta. I made the complex using Alphafold but how to see this complex along with the membrane? Is there some command for it please? I would appreciate your kind help. Thanks Ranti Best wishes, Ranti Dev Shukla Visiting Fellow, NIH, Rockville, MD Email: rantibio2(a)gmail.com *rantibio3(a)gmail.com <rantibio3(a)gmail.com>* Phone: +1 865-910-2985 *Teachers* make a lasting impact in the lives of their students

2 1

Rotation of the multi-model object using the symmetric axis
by Enrico Martinez 03 Jun '24

03 Jun '24

Dear Chimera-X users! I am dealing with the visualisation of a complex dimer where each monomer is defined as a separate model like #1 and #2. For visualisation purposes I need to rotate the input construct by 180 degrees with the axis of rotation in the middle between the two monomers to avoid the shift of the complex in the x-plane at the end. That's what I have tried: # turn on 180 deg during 10 sec roll y 0.72 250 center #1,2 protein wait 250 but the construct still shifted a bit towards one of the monomers. How could I do ii using the rotation axis, which would be in the center between them ? Many thanks in advance Enrico

3 4

Conversion of multiple files into PDB
by Enrico Martinez 03 Jun '24

03 Jun '24

Dear ChimeraX Users ! I am dealing with the analysis of multiple structural coordinates generated by AlphaFold for a target protein in *.cif extension. My goal is superimpose all the coordinates to the first model and save them in .pdb as separate files. So my script could be: open ./*.cif match #2-6 to #1 # probably there is a better solution # and some command for save What could be the solution to save all the coordinates in automatic way in separate pdb with the name patterns corresponded to the ID of these models ? Many thanks in advance Enrico

3 3

attributes from viewdockx.
by Krishnan Raman 31 May '24

31 May '24

Hi guys, * Make ViewDockX table information available as model attributes<https://rbvi.github.io/chimerax-recipes/vdx_attrs/vdx_attrs.html>. December 17, 2021 Used this Py to register my attributes into chimerax. Is there a way to display the attributes next to the model of the ligand? Thanks Krish Krishnan Raman Executive Director, Structural Biology BioCryst Pharmaceuticals CONFIDENTIALITY NOTICE This email, including any attachments, may contain confidential or legally privileged information that is intended only for the individual or entity to whom it is addressed. If you are not the intended recipient, please be advised that any dissemination, distribution or copying of this email and any attachment is strictly prohibited. If you have received this email in error, please reply to the sender so that BioCryst Pharmaceuticals, Inc. can take corrective measures and then permanently delete this email and any attachment, including any printed copies. Thank you.

2 5

Grid mode for multiple superimposed models
by Enrico Martinez 31 May '24

31 May '24

Dear ChimeraX users ! I am working on the structural analysis of the predictions of the alpha fold loaded in Chimera as different models. Do we have an option that would allow us to take each model as an element of the grid so that the superimposed models could be displayed side by side (e.g. in one row for 1-3 models or in 2 rows for 4-6 models etc)? I've seen this option in P*mol, but would like to try it in ChimeraX if it exists! Many thanks in advance Enrico

2 2

ChimeraX question
by Meden Isaac-Lam 30 May '24

30 May '24

Hello UCSF Chimera Team, I used Chimera and AutoDock Vina about 2 years ago. I just downloaded ChimeraX and I am trying to learn it. However, I forgot how to link AutoDock Vina. In the previous Chimera, it was under Tools and Surface Binding Analysis. Any suggestion on how to do it? Thanks. Your assistance is greatly appreciated. Sincerely, Meden F. Isaac-Lam Purdue University Northwest

2 2

Error installing bundle: No module named pandas
by Ricardo Righetto 29 May '24

29 May '24

Hi, Not sure if this should be reported here or to the bundle developers directly, but in any case here it goes: When trying to install the ArtiaX plugin on ChimeraX v1.7.1 on Ubuntu 22.04 from the toolshed (both via command line and through the GUI) I ran into the following error: *** error: subprocess-exited-with-error × python setup.py egg*info did not run successfully. │ exit code: 1 ╰─> [10 lines of output] Traceback (most recent call last): File "", line 2, in File "", line 34, in File "/tmp/pip-install-ni7khioh/starfileddcd2480b29b4cad9233c413b6568ba0/setup.py", line 2, in from starfile.version import VERSION File "/tmp/pip-install-ni7khioh/starfile_ddcd2480b29b4cad9233c413b6568ba0/starfile/__init* .py", line 1, in from .functions import open, read, new, write, version, star2excel File "/tmp/pip-install-ni7khioh/starfile _ddcd2480b29b4cad9233c413b6568ba0/starfile/functions.py", line 3, in import pandas as pd ModuleNotFoundError: No module named 'pandas' [end of output] note: This error originates from a subprocess, and is likely not a problem with pip. error: metadata-generation-failed × Encountered error while generating package metadata. ╰─> See above for output. note: This is an issue with the package mentioned above, not pip. hint: See above for details . *** That is, it was complaining that the pandas package was missing when trying to install the starfile package, which in turn is a dependency of ArtiaX. I'm puzzled why it wasn't able to install pandas by itself, since it is listed as a dependency of starfile. Anyway, after trying many different things, I found out that I could install pandas via pip directly through the ChimeraX command line interface: pip install pandas And after that the bundle installation worked just fine. Not sure what to make of this, but maybe it's useful to developers or other users running into the same issue. Thank you, -- Ricardo Diogo Righetto

1 0

Question Regarding rangecolor kdHydrophobic command
by Knotts, Garrett 29 May '24

29 May '24

Good morning, I am in the process of switching over from Chimera to ChimeraX. I have found ChimeraX to be incredibly more user friendly and well-designed. I wanted to reach out regarding the rangecolor kdHydrophobic command. I often use this command in chimera to color protein surfaces based on hydrophobic character. However, we have a color scheme which our lab has consistently used. In the switch from Chimera to ChimeraX, I have not found a way to color by hydrophobicity with our color scheme using this or other commands, but I have found a way to color hydrophobic regions onto surfaces, without the ability to change the colors. Is there a way to do this in ChimeraX? Thanks for the help! Best, _______________________________ Garrett Knotts Undergraduate Lab Assistant (Johnson Lab) Legislative Director of the Mississippi State University Student Association Vice President of Honors Ambassadors Sigma Phi Epsilon Learning Community Coordinator [cid:8783bc97-b3f7-4f42-85c5-130c16ad956f]

2 1

Behavior of "cd" when executed through a script
by Vorländer,Matthias Kopano 29 May '24

29 May '24

Dear ChimeraX team, I have a series of scripts that contain a “cd” statement to set the working directory. I execute the scripts (which opens a model and map and colors the map). I then manually adjust the orientation and threshold and want to save a picture with “save map.png” (I want this png tp be saved in the folder that I set with the script). I have noticed that in this scenario ChimeraX has “forgotten” the cd statement from the script file and has fallen back to default working directory (or the last working directory manually set in the session before I exectuted my script). At least for me it would be more convenient and logical if the working directory can be set and maintained after habing executed a script. Note: if I don’t execute the script by double clicking but by copy/paste, the working directory is correctly maintained. Would be great if the behavior could be adjusted 😊 Many thanks and best wishes, Matthias

2 3

Command not found from cxc file v1.7.1 on M2 Mac
by Hong Glenn Meng ZHAN 29 May '24

29 May '24

Evening all, I was trying to color code my imod models based on their volume (see attached). It worked ok for me just one model file opened in ChimeraX. When I was doing anther model file, I can passed the individual command in the command line to change color: color #1.1 #ceecc8 However, when I generate a cxc file and open it from command line or click on Open, it showed Unknown command: color #1.1 #ceecc8 Any input where I was not doing correctly? Thanks for helping! -Hong [Screenshot 2024-05-28 at 11.22.11 PM.png][image2.png]

2 2

Python scripting for Dipole moment calculation
by andreumormaldon＠outlook.com 28 May '24

28 May '24

Hi all! I am trying to calculate the dipole moment of different proteins at different pH values. The .pdb and .dx files are generated with pdb2pqr and apbs software. I have found a script that is written for chimera, but it seems that the modules are not translated to ChimeraX, or at least I am not able to make it work. So I have decided to try to write my own script. So far I am able to obtain the center of mass of the protein as well as the charges of all the atoms in the molecule, but I cannot find a way to build a vector to where calculate the dipole (as it is done in the chimera script). Can anyone give me some insights? Does ChimeraX have as well the class Vector and Point? Thank you very much for your help! Best, Andreu

2 1

Is it possible to set attribute on chain via Python script?
by Artie Kushner 28 May '24

28 May '24

I apologize in advance if this is off topic. I heard that people use chimerax mailing list to share tips and ask for help and saw some archives online that came in handy. I'm wondering if it's possible to set an attribute on the whole atomic chain (for future byattribute coloring) the way it is done in the example with Atom/Residue ? ( https://rbvi.github.io/chimerax-recipes/helixmlp/helixmlp.html) I'm trying something similar in my script: ``` from chimerax.core.commands import run from chimerax.atomic import Residue, Atom, Chain # the regular Cmd setup.. c:Chain polyclass:str = ... input from external spruce c.polymer_class = polyclass Chain.register_attr(session, 'polymer_class', 'Polymer Class', attr_type = str) ``` But when i run `color byattribute polymer_class /6 palette lipophilicity` it's not getting picked up: `No known/registered numeric attribute polymer_class`. Maybe it's not possible to color by string attributes? Thanks a lot for your advice Artem

2 2

Morph Trajectory to smooth motion
by Alexander Hung Lee 26 May '24

26 May '24

I've morphed between a series of models/submodels to create a smooth trajectory but is it possible to morph a loaded trajectory that's topology and trajectory file (.nc)? Or is there another way to smooth the motion of it if morph is just to create a trajectory between models? Alex Lee PhD Student Woods Research Group<https://woodsgroup.franklinresearch.uga.edu/> Department of Biochemistry & Molecular Biology Complex Carbohydrate Research Center University of Georgia 315 Riverbend Rd. Athens, GA 30602 Email: ahl63010(a)uga.edu Mobile: (470) 641-3884

2 1

Surface caps not drawn in script
by Daniel Asarnow 25 May '24

25 May '24

Hi Tom/Elaine, I have a series of models with SES surfaces and per-model clipping, and I am trying to create figures for each in a script with several blocks like the following: hide target m show #1 target ms save fig1.png If I run the commands myself, the figures are as expected, but when I run the script / copy and paste several of these blocks, the surface caps aren't drawn. Am I missing something? Or can I trigger the caps somehow? Thanks! Best, -da

2 3

Re: Reg. alphafold contacts maxPae parsing
by Greg Couch 24 May '24

24 May '24

HI Anthony, Please send all ChimeraX question to the chimerax-users mailing list, so the appropriate person can answer you. While in general I am not involved with the alphafold support, in this particular case, I believe the answer is to use the current ChimeraX release candidate or daily build. Alphafold 3 changed the PAE format, so new code had to be written. And that has been mentioned on the mailing list, so if you are not already a member, I recommend joining. -- Greg On 5/24/2024 6:24 AM, Antony Merlin Jose wrote: > Dear Greg, > I have been using the alphafold contacts to parse the .pkl files to > show the pseudobonds in ChimeraX (e.g., alphafold contacts #1/A to > #1/B maxPae 5 distance 6). The .pkl files were generated from a > locally installed Alphafold 2.3. Now that there is an AlphaFold 3 > server, (https://golgi.sandbox.google.com/) I ran some complexes on > there and downloaded the results. The results include .json files that > have the PAE information. Would using the same commands with this file > also result in the correct parsing of the PAE values? How can I see > the python code that corresponds to each command on ChimeraX? > Thank you > Best, > Antony >

3 2

Zn fingers
by Dyda, Frederick (NIH/NIDDK) [E] 24 May '24

24 May '24

I have a structure with some Zn fingers. How can I describe the Zn2+ tetrahedral environment for Isolde? Cryo EM density is less than spectacular... Thanks. Fred ******************************************************************************* Fred Dyda, Ph.D. Phone:301-402-4496 Laboratory of Molecular Biology Fax: 301-496-0201 NIDDK Bldg. 5. Room 338 e-mail: Fred.Dyda(a)nih.gov Bethesda, MD 20892-0560 URGENT message: 2022476710(a)msg.fi.google.com Google map: 39.001168, -77.102048 http://www-mslmb.niddk.nih.gov/dyda/dydalab.html *******************************************************************************

2 1

Fwd: some more clarifications on this?
by Eric Pettersen 23 May '24

23 May '24

> Begin forwarded message: > > From: Krishnan Raman <RKrishnan(a)BIOCRYST.com> > Subject: some more clarifications on this? > Date: May 23, 2024 at 8:22:08 AM PDT > To: "chimerax-users-owner(a)cgl.ucsf.edu" <chimerax-users-owner(a)cgl.ucsf.edu> > > Aligning two VR headsets in one room. Two Vive or Vive Pro VR headsets can be used in the same room, each connected to its own computer. Each headset uses the same pair of base stations. A problem sometimes arises that the two headsets do not see the ChimeraX structures displayed at the same location in the room. Specifically, one headset may see the structure positions as if the room is rotated 180° relative to the other headset. This happens because the SteamVR room setup is run separately on each computer and produces a different coordinate system. For structures to have the same room position in both headsets, the room boundaries traced using SteamVR room setup should be the same for both computers. The first step of SteamVR room setup in which users are asked to point the hand controller at the screen and click is the key to avoiding 180° misorientation. At that step, it is important to point along the short axis of the rectangle defining the room bounds (that will be traced in a later step). SteamVR chooses between two coordinate system orientations rotated 180° from each other based on the direction of pointing. If pointing is along the long axis of the rectangle bounds, a slight tilt toward the left or right of the long axis produces opposite coordinate system orientations. Pointing along the short axis instead is a reliable way to make both computers use the same orientation. (The computer screen position is irrelevant.) > > https://www.cgl.ucsf.edu/chimerax/docs/user/commands/meeting.html#:~:text=T… <https://www.cgl.ucsf.edu/chimerax/docs/user/commands/meeting.html#:~:text=T…>. > > I was successful in doing a hybrid meeting with one 2d monitor and one VR headset (quest pro) -air linked. I do see that my images in the VR are rotated by 180 deg. With respect to the 2d monitor. Do I still have to run steam vr on both computers to bring them into same coordinate system? > > > > Krishnan Raman > Executive Director, Structural Biology > BioCryst Pharmaceuticals > > > > > CONFIDENTIALITY NOTICE > > This email, including any attachments, may contain confidential or legally privileged information that is intended only for the individual or entity to whom it is addressed. If you are not the intended recipient, please be advised that any dissemination, distribution or copying of this email and any attachment is strictly prohibited. If you have received this email in error, please reply to the sender so that BioCryst Pharmaceuticals, Inc. can take corrective measures and then permanently delete this email and any attachment, including any printed copies. Thank you. >

2 1

Re: Replies from mailing list not send to inbox
by Alexander Hung Lee 23 May '24

23 May '24

In reply to Elaine Meng, I went to this link but it already confirmed "Member already subscribed." I also didn't get a direct email from you even though you included my individual email address. Currently replying by going to the mail archive and clicking the reply button in the thread. https://mail.cgl.ucsf.edu/mailman/mailman3/lists/chimerax-users.cgl.ucsf.ed… Alex Lee PhD Student Woods Research Group<https://woodsgroup.franklinresearch.uga.edu/> Department of Biochemistry & Molecular Biology Complex Carbohydrate Research Center University of Georgia 315 Riverbend Rd. Athens, GA 30602 Email: ahl63010(a)uga.edu Mobile: (470) 641-3884

2 1

Re: Match atoms
by Alexander Hung Lee 23 May '24

23 May '24

Thanks Elaine! Alex Lee PhD Student Woods Research Group<https://woodsgroup.franklinresearch.uga.edu/> Department of Biochemistry & Molecular Biology Complex Carbohydrate Research Center University of Georgia 315 Riverbend Rd. Athens, GA 30602 Email: ahl63010(a)uga.edu Mobile: (470) 641-3884

1 0

Replies from mailing list not send to inbox
by Alexander Hung Lee 23 May '24

23 May '24

Hi everyone, Earlier I had sent a help request "Match Atoms." After looking in the online mail archive, I found that I received replies to my problem, but didn't get an email. How do I fix this? I accidentally sent the email again thinking it wasn't received... Sorry, Alex Lee PhD Student Woods Research Group<https://woodsgroup.franklinresearch.uga.edu/> Department of Biochemistry & Molecular Biology Complex Carbohydrate Research Center University of Georgia 315 Riverbend Rd. Athens, GA 30602 Email: ahl63010(a)uga.edu Mobile: (470) 641-3884

2 1

Match atoms
by Alexander Hung Lee 23 May '24

23 May '24

Hi everyone, I'm trying to use the match command (not matchmaker) to align the ring atoms of a ligand. The command gives "No matrix compatible with both reference structure and all match structure" and translates the match command to matchmaker in the reply log. However, in Chimera I'm able to align jjst those ring atoms with the match command. Of course, using matchmaker on just those atoms in Chimera gives "No chains in reference structure #1 compatible with BLOSUM-62 similarity matrix" tl;dr. Trying to align ring atoms of a ligand instead of protein chain Chimerax mask 1 = #1:203@C19,C20,C21,C16,C17,O18 mask 2 = #2:125@C2,C3,C4,C5,C6,O6 matchmaker: No matrix compatible with both reference structure and all match structures match: Same as above. In reply log, match is extended to matchmaker Chimera mask 1 = #0:203@C19,C20,C21,C16,C17,O18 mask 2 = #1:125@C2,C3,C4,C5,C6,O6 matchmaker: No chains in reference structure #1 compatible with BLOSUM-62 similarity matrix match: Gives me RMSD ** I need this atom match functionality in ChimeraX Alex Lee PhD Student Woods Research Group<https://woodsgroup.franklinresearch.uga.edu/> Department of Biochemistry & Molecular Biology Complex Carbohydrate Research Center University of Georgia 315 Riverbend Rd. Athens, GA 30602 Email: ahl63010(a)uga.edu Mobile: (470) 641-3884

4 8

Fwd: Uncaught bounce notification
by Eric Pettersen 22 May '24

22 May '24

> Begin forwarded message: > From: Allen Place <place(a)umces.edu> > Subject: Re: Your message to chimerax-users(a)cgl.ucsf.edu awaits moderator approval > Date: May 16, 2024 at 5:11:31 AM PDT > To: chimerax-users-bounces(a)cgl.ucsf.edu > > > Help with commands. I know how to Select regions in my protein sequence, but How do I select different colors for those selections? These are various modules that I have assigned prior to the prediction based on homology. > Al > > >> On May 15, 2024, at 9:45 AM, chimerax-users-bounces(a)cgl.ucsf.edu wrote: >> >> Your mail to 'chimerax-users(a)cgl.ucsf.edu' with the subject >> >> Alphafold3 models >> >> Is being held until the list moderator can review it for approval. >> >> The message is being held because: >> >> The message is not from a list member >> >> Either the message will get posted to the list, or you will receive >> notification of the moderator's decision. > > Allen R. Place(he/him/his) > Professor, Associate Director of Research, > Director of BASLab, Director of HAB-CTI > Institute of Marine and Environmental Technology > University of Maryland Center for Environmental Sciences > The Rita Rossi Colwell Center > 701 East Pratt Street > Baltimore, MD 21202 > 410-234-8828 > place(a)umces.edu > > ALAN, ALLAN, ALLEN > From the Gaelic word for “cheerful” > > He is smart, makes friends easily, and never loses his sense of humour. > > He thrives on a challenge > > > Sign up to receive our quarterly newsletter, Inside IMET! > > >

3 4

Improvement suggestion
by Lionel Carlo Clarens 22 May '24

22 May '24

Dear User List, I am a frequent user of ChimeraX. Currently, the only way to create animations is via the command line. In contrast, the older Chimera version has an intuitive, user-friendly interface for making simple and effective animations. It would be an excellent and straightforward improvement to migrate this functionality from Chimera to ChimeraX, as I currently need to use both software. Best regards, Lionel C.

2 2

question about using ChimeraX
by 天剑流痕 21 May '24

21 May '24

This chimerax software is very useful. Could you please tell me how to connect two amino acid residues or atoms in the protein 3d diagram 天剑流痕 475514296(a)qq.com  

2 1

Sign up for the user group's email list
by Md Saiful Islam - MRC LMB 20 May '24

20 May '24

Hi Is it possible please to add me to the Chimera X user group's email list. Cheers Saif

2 1

Doubt
by GOTZONE BARANDIKA 19 May '24

19 May '24

Dear developers, I am a new user of ChimeraX. I need to create dimers in order to analyse adsorbate-adsorbant interactions for DFT calculation. I am able to create the image on the screen, but I don´t know how to save the atomic coordinates of the dimer in a single file. If I save a .pdb file in order to produce a .xyz file, just the information of one of the entities is kept. Can you please help me? [cid:image003.jpg@01DAA921.4F8EE270] Best regards, [Diapositiva1]

2 2

How to copy fitted monomer in a symmetric map?
by Noha Elhosseiny 18 May '24

18 May '24

Hi, I have a map with C15 symmetry in which I already refined the fitting of a single monomer (asymmetric unit) in the map using coot. I now want to generate the complete 15-mer atomic model. I watched your tutorial : ( https://youtu.be/v3jI43YJQMg?si=WeQg2ef2MPOw2J7H) and I tried to use the command "sym #2 (my model) C15 to do that, but instead of getting the monomers fitted around the axis of symmetry, I could see that 15 versions were visible but in a circular circumference around my map, away from the center, and the monomers are widely spaced from one another. I kind of expected this because I did not specify any coordinates to do this copying, so how can I fix this? Another question: when I use the command "measure symmetry" I get "C3, center 270 270 244". So I do not understand why it's detecting a C3 when it's clearly a C15. I think the above coordinates of the center can be used to solve my fitting problem but I am not exactly sure how. Finally I understood that even if the monomers appear properly fitted, given I manage to do it, that these are just graphical copies. So how can I then make real copies of the graphical representation of the 15-mer? Thanks Noha -- *Noha M. Elhosseiny, PhD* Department of Microbiology & Immunology Faculty of Pharmacy, Cairo University. Kasr El-Ainy St, Cairo, Egypt, 11562- Lab C-407 Website: https://eg.linkedin.com/in/nohaelhosseiny <https://eg.linkedin.com/in/nohaelhosseiny>

4 7

Re: Displaying surface model of blob clostest to a centroid
by Tom Goddard 18 May '24

18 May '24

Hi Yoseph, So you have a volume and you have markers shown in ChimeraX and you wanted to show only the connected surface piece from the volume contour surface that is closest to a specific marker? Do I have that right? You show in your image a lot of markers, but you only want to find the surface piece close to one of them? And you just want to show it and hide all the other parts of the surface? What if the closest surface piece is far away? Or what if a tiny spec of surface is close, but a bigger surface piece is nearby? I think that would require writing some Python code. There is nothing in ChimeraX that I can think of that computes connected surface pieces that are close to a marker. Did you consider just showing a zone of the surface around the marker out to a certain specified distance? The ChimeraX surface zone command does that, described here https://www.cgl.ucsf.edu/chimerax/docs/user/commands/surface.html#zone Tom > On May 17, 2024, at 4:05 PM, Yoseph Loyd <yoseph.loyd(a)mines.sdsmt.edu> wrote: > > Hi Tom, > > Sorry I was having a difficult time uploading an example image to the form. I'll attach it below, I'm displaying tracked centroids as small spheres. I was hoping that there existed a way to display the nearest yellow blob to the tracks I care about. The yellow blobs signal wise are full binary objects. Thank you for helping me with this. > > Best, > Yoseph > > On Fri, May 17, 2024 at 4:43 PM Tom Goddard <goddard(a)sonic.net <mailto:goddard@sonic.net>> wrote: >> Hi Yoseph, >> >> I don't know what you mean "objects that fit to a centroid that I've tracked". What kind of object? The centroid of what? And why isn't it displayed currently? You'll have to explain better. >> >> Tom >> >> > On May 17, 2024, at 2:07 PM, Yoseph Loyd via ChimeraX-users <chimerax-users(a)cgl.ucsf.edu <mailto:chimerax-users@cgl.ucsf.edu>> wrote: >> > >> > Hi, >> > >> > My name is Yoseph, I was wondering if there is a way to display objects that fit to a centroid that I've tracked and imported into chimera. Thank you for taking the time to read this and have a nice day. >> > >> > >> > Best, >> > Yoseph >> > _______________________________________________ >> > ChimeraX-users mailing list -- chimerax-users(a)cgl.ucsf.edu <mailto:chimerax-users@cgl.ucsf.edu> >> > To unsubscribe send an email to chimerax-users-leave(a)cgl.ucsf.edu <mailto:chimerax-users-leave@cgl.ucsf.edu> >> > Archives: https://mail.cgl.ucsf.edu/mailman/archives/list/chimerax-users@cgl.ucsf.edu/ >> > >>

2 2

Displaying surface model of blob clostest to a centroid
by yoseph.loyd＠mines.sdsmt.edu 17 May '24

17 May '24

Hi, My name is Yoseph, I was wondering if there is a way to display objects that fit to a centroid that I've tracked and imported into chimera. Thank you for taking the time to read this and have a nice day. Best, Yoseph

2 1

Re: [Chimera-users] Saving symmetry model in pdb format
by Elaine Meng 17 May '24

17 May '24

Hi Kailash Singh Bisht, You sent the message to chimera-users which is for Chimera questions. However, you said "ChimeraX team" so I am guessing that you are actually using ChimeraX, and I CC'd the chimerax-users address above -- please use that one for ChimeraX questions. You didn't say how you created the symmetry structure. I am guessing that when you create the symmetry structure with the "sym" command, you need to include the option "copies true" so that you get real atomic copies instead of just graphical clones. <https://rbvi.ucsf.edu/chimerax/docs/user/commands/sym.html> <https://rbvi.ucsf.edu/chimerax/docs/user/commands/sym.html#copies> I hope this helps, Elaine ----- Elaine C. Meng, Ph.D. UCSF Chimera(X) team Resource for Biocomputing, Visualization, and Informatics Department of Pharmaceutical Chemistry University of California, San Francisco > On May 17, 2024, at 12:27 AM, Kailash Singh Bisht via Chimera-users <chimera-users(a)cgl.ucsf.edu> wrote: > > Hello ChimeraX team > > I am trying to export the symmetry structure of the protomer virus protein as a pdb file but whenever I am saving that model it only saves the same protomer instead of the whole symmetry structure. Can you please help? How to export those symmetry models as PDB files > > -- > With Regards > Thanking You > > Kailash Singh Bisht > Ph.D. Student

2 1

prediction of 5mC modification and transcription factor interaction through AlphaFold 3
by Kaan Okay - HI 17 May '24

17 May '24

Hi, I use Alphafold through UCSF ChimeraX. It is a very nice tool, I believe its developers have done a good job. As you know, AlphaFold 3 is a new model that allows us to predict DNA modification and protein interactions (https://www.nature.com/articles/s41586-024-07487-w) What I wonder is when this model will be transferred to UCSF ChimeraX and whether we can predict protein interactions and DNA modifications (e.g., 5mC modification on cytosine bases in DNA). I'm looking forward to hearing from you. All the best.

2 1

Cinematographic effects in MD movie recording
by Enrico Martinez 17 May '24

17 May '24

Dear Chimera-X users ! I would like to add some cinematographic effects such as changing the camera angle back and forth during a short recording time of MD movies. Could you suggest some scripting tricks that I could add to the following coordset routine: # start recording movie record size 3840,2160 supersample 1 ## play movie from beginning to the end coordset #1 1,1000,1 wait 1000 etc Would it be possible to bend the camera automatically e.g. during the first 250 steps of recording ? Any other possibilities ? Yours with thanks Enrico

2 17

Displaying angles in chimera
by Prathvi Singh 16 May '24

16 May '24

Hi Elaine, Is it possible in chimera/chimeraX to display angles between two covalent bonds like in pymol? -- Prathvi Singh, Research Fellow, Department of Biological Sciences & Bioengineering, Indian Institute of Technology, Kanpur-208016

2 1