- ChimeraX-users - RBVI Mailing Lists

Where has the ribbon style editor gotten to?
by Dearborn, Altaira (NIH/NIAID) [E] 28 Jun '24

28 Jun '24

I tried the NIH3D presets to prepare my structure for 3D printing. The large size of the complex, however, makes those settings still too lacey for the NIH 3D printing service. I need to edit the ribbon sizes. The youtube tutorials from the NIH 3D Printing Exchange are 7-10 years old and their instructions to open the Ribbon Style Editor no longer match chimerax. Has this feature been renamed and moved? Thank you, Altaira Dearborn

2 1

NICE DCV graphics error
by georg.kempf＠fmi.ch 28 Jun '24

28 Jun '24

Dear ChimeraX developers and users, we would like to use ChimeraX in a virtual session using the “NICE DCV” software. We verified that OpenGL hardware rendering is working in the virtual session (glxinfo, glxgears, nvidia-smi) but when opening a structure in ChimeraX, we get the below error. We tried it with different versions of ChimeraX (1.8.dev202311220127, 1.6.1 stable) on Ubuntu 20.04.6 LTS. Since the error doesn’t appear when using ChimeraX on the physical display of the same workstation(s) (where the DCV server is running) it must be related to the virtual session context. I was wondering if anyone knows what could be the cause of the error and in which direction to look regarding debugging? This is the traceback from ChimeraX: An error occurred in drawing the scene. Redrawing graphics is now stopped to avoid a continuous stream of error messages. To restart graphics use the command "graphics restart" after changing the settings that caused the error. GLError( err = 1282, description = b'invalid operation', baseOperation = glDrawBuffer, cArguments = (GL_NONE,) ) Traceback (most recent call last): File "/chimerax/usr/lib/ucsf-chimerax-daily/lib/python3.11/site-packages/chimerax/core/updateloop.py", line 84, in draw_new_frame view.draw(check_for_changes = False) File "/chimerax/usr/lib/ucsf-chimerax-daily/lib/python3.11/site-packages/chimerax/graphics/view.py", line 188, in draw self._draw_scene(camera, drawings) File "/chimerax/usr/lib/ucsf-chimerax-daily/lib/python3.11/site-packages/chimerax/graphics/view.py", line 226, in _draw_scene shadow, multishadow = self._compute_shadowmaps(opaque_drawings, transparent_drawings, camera) ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ File "/chimerax/usr/lib/ucsf-chimerax-daily/lib/python3.11/site-packages/chimerax/graphics/view.py", line 626, in _compute_shadowmaps multishadow_enabled = r.multishadow.use_multishadow_map(shadow_drawings) ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ File "/chimerax/usr/lib/ucsf-chimerax-daily/lib/python3.11/site-packages/chimerax/graphics/opengl.py", line 1628, in use_multishadow_map self._start_rendering_multishadowmap(center, radius, size) File "/chimerax/usr/lib/ucsf-chimerax-daily/lib/python3.11/site-packages/chimerax/graphics/opengl.py", line 1711, in _start_rendering_multishadowmap fb = r.start_depth_render(self._multishadow_map_framebuffer, ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ File "/chimerax/usr/lib/ucsf-chimerax-daily/lib/python3.11/site-packages/chimerax/graphics/opengl.py", line 1356, in start_depth_render if not fb.activate(): ^^^^^^^^^^^^^ File "/chimerax/usr/lib/ucsf-chimerax-daily/lib/python3.11/site-packages/chimerax/graphics/opengl.py", line 2309, in activate fbo = self.framebuffer_id ^^^^^^^^^^^^^^^^^^^ File "/chimerax/usr/lib/ucsf-chimerax-daily/lib/python3.11/site-packages/chimerax/graphics/opengl.py", line 2305, in framebuffer_id self._fbo = fbo = self._create_framebuffer() ^^^^^^^^^^^^^^^^^^^^^^^^^^ File "/chimerax/usr/lib/ucsf-chimerax-daily/lib/python3.11/site-packages/chimerax/graphics/opengl.py", line 2141, in _create_framebuffer fbo = self._create_fbo(self.color_texture or self._color_rb, ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ File "/chimerax/usr/lib/ucsf-chimerax-daily/lib/python3.11/site-packages/chimerax/graphics/opengl.py", line 2169, in _create_fbo GL.glDrawBuffer(GL.GL_NONE) File "src/errorchecker.pyx", line 58, in OpenGL_accelerate.errorchecker._ErrorChecker.glCheckError OpenGL.error.GLError: GLError( err = 1282, description = b'invalid operation', baseOperation = glDrawBuffer, cArguments = (GL_NONE,) ) Many thanks! Kind regards, Georg

5 4

ChimeraX install problems
by Alexander Hung Lee 27 Jun '24

27 Jun '24

I tried to install ChimeraX daily build on a fresh install of Ubuntu 24. When I launch the program, the log says "Available bundle cache has not been initialized yet." Another oddity I"ve noted is that tying to run a python script w/ "chimerax --nogui --silent --offscreen --script path/to/script" works but "chimerax --script path/to/script" doesn't. I just get a black screen. There also isn't a stable build for Ubuntu 24, only daily builds. Should I downgrade my OS? Alex

2 1

induce mutations in protein structure
by Mamadou Sangare 27 Jun '24

27 Jun '24

Dear, I'm new in chimera and I wouldlike to know how to induce mutations in protein structure, in other words, how to replace one residue by another in the protein structure. Kind regards! Mamadou SANGARE, PhD student ACE-B,Mali

2 1

Feature suggestions for the Segmentations tool
by Ricardo Righetto 27 Jun '24

27 Jun '24

Hi, Thanks a lot for adding the Segmentations mode in v1.8, this is very much welcomed for cryo-ET data! Are there any plans for expanding the capabilities of this tool? If possible, I would like to suggest some features for manual segmentation: * Segment contiguous density in 3D by clicking on it (akin to the blob selector in the "Right Mouse" options, which operates on surfaces) * Related: threshold-based segmentation i.e. segment in 3D all contiguous density between selected minimum and maximum density thresholds * 2D/3D Lasso-based segmentation * Dilation, erosion and smoothening of segmentations Some of these things are already possible by combining volume and surface operations or with external tools, but it would be very nice to have everything streamlined in one click (or a few) through the GUI. Alternatively, I would appreciate pointers on how to implement these features as a ChimeraX plugin. Happy to discuss more. Thank you and have a nice weekend! -- Ricardo Diogo Righetto

2 3

Re: ChimeraX does not Support .stl files?
by Zach Pearson 26 Jun '24

26 Jun '24

Hi Kevin, Please direct questions about ChimeraX to our mailing list, chimerax-users(a)cgl.ucsf.edu <mailto:chimerax-users@cgl.ucsf.edu> — others on the team or even in the community may have more experience or more recent experience in a given subject than I or any other developer has at the moment. Eric (CC’ed) has been working on the NIH 3D pipeline; part of that pipeline is adding struts to delicate objects for 3D printing. He may be able to help you better than I can. — Zach > On 26 Jun 2024, at 14:55, Maroney, Kevin James <kmaroney(a)uab.edu> wrote: > > Hello Dr. Pearson, > Despite doing more Immunology research and really no proteomics, I have had a hobby interest in fooling around with Pymol and ChimeraX. I just recently got a very nice 3D Printer and was hoping to print out a model of the epitope of my PhD complexed between HLA-B57 and TCR that is publically available. I was going to use UCSF Chimera, but it does not seem like it is capable of representing space-filling diagrams and only gives me errors. I obviously can’t print the complex and delicate ribbon or atomic representations and like ChimeraX better anyway. But the guide from the NIH suggests passing PDB models through Chimera to generate .stl files which I can easily then pop into my Studio software to 3D print and resize etc. Problem is, I don’t see that there is any way to actually export as .stl in ChimeraX. Is there any way you could add this feature? Thank you very much. Lovely program. > > Sincerely, > Kevin Maroney > M.S. Biotechnology > University of California, Irvine > PhD Student > University of Alabama at Birmingham

3 2

transparency using in movie making
by Yanhe Zhao 26 Jun '24

26 Jun '24

Dear ChimeraX team, I have a map with model docking and am making movie. My plan is to fade away the map to show the docked model for next step. I tried the crossfade which works. But I want to use the transparency command for this purpose because I want to keep the map at specific transparency level, like 80%. The chimera has command like 'surftransparency 80 #1 50'. I was wondering what is the similar command in ChimeraX? Thanks and cheers, Yanhe

2 2

Sequence based selections
by Kumpula, Esa-Pekka 26 Jun '24

26 Jun '24

Dear ChimeraX team, Two selection-related questions: 1. I'm looking for a way to combine multiple sequence based selections into one selection but I wasn't able to find a way to do this. The use case is, I have a lot of models that have these two proteins and I would like to use them together for superposition (via align command against Calphas). I would normally refer to them by chain ID, but here these are not consistently assigned so I need to use the sequence for selection. 1. Is it possible to have a named, sequence-based selection that, when called, would perform the selection? This would save a lot of pain when writing scripts for sequence based selections. Cheers, EP -- Esa-Pekka Kumpula, PhD Senior Postdoctoral Researcher Laboratory of Structural Biology Institute of Biotechnology Helsinki Institute of Life Science HiLIFE University of Helsinki www.helsinki.fi/lsb<http://www.helsinki.fi/lsb>

3 2

Generic Linux installation package for ChimeraX 1.8
by Kumpula, Esa-Pekka 26 Jun '24

26 Jun '24

Dear ChimeraX team, I noticed that version 1.8 no longer comes with a "Generic Linux" installation package (unlike 1.7). I have been using this for a centralised installation on a network drive that has so far worked very well. Is this coming to 1.8 or is it discontinued? Cheers, Esa-Pekka -- Esa-Pekka Kumpula, PhD Senior Postdoctoral Researcher Laboratory of Structural Biology Institute of Biotechnology Helsinki Institute of Life Science HiLIFE University of Helsinki www.helsinki.fi/lsb<http://www.helsinki.fi/lsb>

2 3

Bundles with dependencies
by Vincent Mallet 24 Jun '24

24 Jun '24

Hello, Thanks for the tool and the tutorials. I have a machine learning tool based on pytorch to analyse cryo-EM data. I was hoping to package (bundle) it for Chimerax and started to follow tutorials, but I don't think you mention the right way to set up a code environment with depencies. I see a numpy import in the save_new_format tutorial, but it's not listed in the "dependencies" section of the xml file. I guess my question is : can I add arbitrary packages in a bundle ? Is there a way to install pip packages only ? Should I copy all source code in the folder and deal with my imports like that ? In particular, I am thinking of torch that is not so easy to replace... I am hoping you can help me, thanks in advance for the help ! Best, Vincent

2 8

Troubleshooting MOLE Channel Visualizations
by Josh Gonzalez 24 Jun '24

24 Jun '24

Hello, I am a newer user of ChimeraX and am having some trouble creating visualizations to characterize a channel of interest. I began by following the procedure outlined in the tutorial "MOLE Channel Coloring by Property" but quickly ran into some issues with my own channel. This led me to try the click-to-execute links for the example in the tutorial and I ran into the same problem. It seems ChimeraX cannot accept .json files that are not Alphafold PAE maps, meaning there is no way to visualize the results of the MOLEsever analysis. I have attempted parsing data from the .json into a usable file format such as a .bild or a .pdb in a separate anaconda kernel, and while I am able to get coordinates for a superimposed visualization, they are not selectable atoms that can be color-coded or manipulated as they are in the procedures following the "open molepore-1bl8.json" command. I know this is because I have not found a way to parse all of the useful data from the .json file into another format, but I do not see exactly how I would go about doing so. Is there a way to get ChimeraX to accept a .json file that is not a PAE plot without the need for parsing data or changing format? Thank you so much for the help!

3 2

Question
by Suwisanto, Natasha 24 Jun '24

24 Jun '24

Hello, My name is Natasha Suwisanto. I’ve been using UCSF Chimera X and AlphaFold servers for a personal research project to mutate a GPCR protein. I just had a quick question. I was mutating a structure using the Rotamer tool on ChimeraX. I mutated a single amino acid (Tyrosine) to a Proline using the Richardson Common Atom library. However, when I ran AlphaFold on it, the predicted 'best model' structure they gave me had a different amino acid (Leucine) on the position I previously mutated the Tyrosine to the Proline. I was just wondering if I did something wrong or if AlphaFold/ChimeraX works differently than I thought. Best, Natasha Suwisanto

2 1

Installing ChimeraX on Linux without sudo
by Ricardo Righetto 24 Jun '24

24 Jun '24

Dear ChimeraX team, Is there any way to install ChimeraX >= 1.8 on Linux without admin rights, like a generic Linux version that I can unpack at an arbitrary location? Our system is running Ubuntu 22.04 more specifically. Thank you! -- Ricardo Diogo Righetto

4 4

Help_saving
by Noriega, Heather 22 Jun '24

22 Jun '24

Hello, I have a question. I created this sphere nanoparticle and have been trying to save it as a PDB (the whole sphere). But when I save "selected atoms, " I try to re-open the PDB file. It only shows the original single Span-60 that was used. Is there a way to save the copies and nanoparticles as a whole so I can minimize them altogether? I attached the session below for your reference. Thanks, Happy Friday! Thank you, Heather Noriega PhD-Pharmaceutical Science student Howard University heather.noriega(a)bison.howard.edu 520-203-1883

2 6

Re: Help_saving
by Elaine Meng 21 Jun '24

21 Jun '24

Sure, if you tell me that works. I wasn't sure if #2 had all 60 or just the other 59 and it would have been another several minutes experimenting. Elaine > On Jun 21, 2024, at 1:53 PM, Tom Goddard <goddard(a)sonic.net> wrote: > > How about execute the second sym command with copies true on model #2 which has the first 60 copies? > > Tom > > >> On Jun 21, 2024, at 1:50 PM, Elaine Meng <meng(a)cgl.ucsf.edu> wrote: >> >> Sigh, I was trying to enlist help in answering the question directly considering I've already spent hours messing around with it... especially if you think it is simple to explain. I don't think it is obvious to expect different numbers of copies just because you wanted them to be atomic instead of graphical. >> >> If she wants 3600 full atomic copies how would she do that?? >> >> Elaine >> >>> On Jun 21, 2024, at 1:35 PM, Tom Goddard <goddard(a)sonic.net> wrote: >>> >>> Hi Elaine, >>> >>> If you don't use copies true, then the first sym command changes model #1 rendering to include 60 graphical clones, and then the second sym command also on model #1 makes 60 graphical clones of the previous 60 graphical clones, so you now have 3600 graphical clones in model #1. You can see this with "info #1" which says "3600 instances". >>> >>> If you use the "copies true" option then the sym command makes a new model #2 with 60 copies. The second sym command on #1 with copies true makes 60 more copies as model #3. Of course that is a very different result then the sequence without copies true because the copies true version makes new models instead of modifying the original model. >>> >>> This all makes sense to me. >>> >>> Tom >>> >>> >>>> On Jun 21, 2024, at 1:25 PM, Elaine Meng <meng(a)cgl.ucsf.edu> wrote: >>>> >>>> Hi Tom, maybe you can figure it out?? >>>> >>>> OK I give up, I did extensive tests and can't figure it out either. I regenerated the original starting molecule (I think), attached as temp.pdb >>>> >>>> Then the overall result visible with the following, which is what she apparently wants (except with real atomic copies) although I worry it may have double copies in places, is a very packed-looking sphere: >>>> >>>> sym #1 i,2n5 center 20,20,20 >>>> sym #1 i,2n3 center 20,20,20 >>>> >>>> However if you start over with temp.pdb and then do the following, you get something much more patchy/holey >>>> >>>> sym #1 i,2n5 center 20,20,20 copies true >>>> sym #1 i,2n3 center 20,20,20 copies true >>>> >>>> I thought it might have something to do with copies replacing other copies but I tried with newModel true and still had seemingly the same issues. >>>> >>>> Maybe the more-packed appearance is actually a bug if sym w/o copies true makes more graphical copies of ones that are already graphical copies. >>>> >>>> Elaine >>>> >>>> <temp.pdb> >>>> >>>> >>>> >>>>> Begin forwarded message: >>>>> >>>>> From: "Noriega, Heather via ChimeraX-users" <chimerax-users(a)cgl.ucsf.edu> >>>>> Subject: [chimerax-users] Re: Help_saving >>>>> Date: June 21, 2024 at 12:14:50 PM PDT >>>>> To: ChimeraX Users Help <chimerax-users(a)cgl.ucsf.edu> >>>>> Reply-To: "Noriega, Heather" <heather.noriega(a)bison.howard.edu> >>>>> >>>>> Hello, >>>>> >>>>> It is quite baffling to me why it does this. I am going to add different sessions to show you what I see. I have included each session to try and separate to explain myself and not confuse. Three of the sessions do not include the copies true command: (sym_2n3, sym_2n5, sym_both). The one with both (sym_2n3 and sym_2n5) gives me the niosome I am quite interested in with an aqueous and lipophilic compartment. I want to do a simple measure of the volume inside the large compartment, but would like to minimize the niosome as a whole first, hence needing a pdb file. However, I have done the same with the next three sessions, but adding copies true command and it is not coming up with the same result for sym_both_copiestrue. >>>>> >>>>> I hope this helps to try and understand what I am looking for, and maybe you have an answer as to why there are different results for Sym_both and Sym_both_copiestrue. >>>>> >>>>> Thank you, >>>>> >>>>> Heather Noriega >>>>> PhD-Pharmaceutical Science student >>>>> Howard University >>>>> heather.noriega(a)bison.howard.edu >>>>> 520-203-1883 >>>>> >>>>> >>>>> On Fri, Jun 21, 2024 at 2:33 PM Elaine Meng <meng(a)cgl.ucsf.edu> wrote: >>>>> Hi Heather, >>>>> >>>>> I don't really understand why you needed two sym commands instead of one (must be something specific about your structure(s)), but whenever you want to actually save the PDB of any parts that "sym" adds you would need to include "copies true" when you add them. >>>>> >>>>> You could just do the experiment with and without it yourself and see what you get. Or save two separate PDB files, one from each command, to make sure you aren't getting duplicates of the same atoms exactly on top of each other from using sym twice. >>>>> >>>>> Elaine >>>>> >>>>>> On Jun 21, 2024, at 9:45 AM, Noriega, Heather via ChimeraX-users <chimerax-users(a)cgl.ucsf.edu> wrote: >>>>>> >>>>>> Hello, >>>>>> >>>>>> I do not want to save the shape of a sphere. I was using that for something else while creating the nano. >>>>>> >>>>>> Ok, that is what I did wrong. I did not include the copies true command. I have a question. I used the commands: >>>>>> >>>>>> Sym #1 i,2n3 center 20,20,20 and Sym #1 2n5 center 20,20,20 to create the sphere. Would I have to add copies true to both commands? >>>>>> >>>>>> sym#1 i,2n3 center 20,20,20 copies true >>>>>> sym#1 i,2n5 center 20,20,20 copies true >>>>>> >>>>>> And then continue with the saving process for PDB >>>>>> >>>>>> >>>>>> Thank you, >>>>>> >>>>>> Heather Noriega >>>>>> PhD-Pharmaceutical Science student >>>>>> Howard University >>>>>> heather.noriega(a)bison.howard.edu >>>>>> 520-203-1883 >>>>>> >>>>>> >>>>>> On Fri, Jun 21, 2024 at 12:37 PM Elaine Meng <meng(a)cgl.ucsf.edu> wrote: >>>>>> Hi Heather, >>>>>> I can't tell what you are trying to save exactly but here are two issues: >>>>>> >>>>>> (1) when you used "sym" the Log said it was making graphical clones. (The log contents are included in the session file.) If you want full atomic copies instead of graphical clones you have to use "copies true" as explained in the help: >>>>>> <https://rbvi.ucsf.edu/chimerax/docs/user/commands/sym.html#copies> >>>>>> >>>>>> (2) The big sphere seems to be a surface model, and you can't save a surface model as PDB format. Maybe you used the "shape" command, which creates surface models. But I can't tell from your message whether you are trying to save that in the file or not. >>>>>> >>>>>> I hope this helps, >>>>>> Elaine >>>>>> ----- >>>>>> Elaine C. Meng, Ph.D. >>>>>> UCSF Chimera(X) team >>>>>> Resource for Biocomputing, Visualization, and Informatics >>>>>> Department of Pharmaceutical Chemistry >>>>>> University of California, San Francisco >>>>>> >>>>>> >>>>>>> On Jun 21, 2024, at 9:16 AM, Noriega, Heather via ChimeraX-users <chimerax-users(a)cgl.ucsf.edu> wrote: >>>>>>> >>>>>>> Hello, >>>>>>> >>>>>>> I have a question. I created this sphere nanoparticle and have been trying to save it as a PDB (the whole sphere). But when I save "selected atoms, " I try to re-open the PDB file. It only shows the original single Span-60 that was used. Is there a way to save the copies and nanoparticles as a whole so I can minimize them altogether? >>>>>>> >>>>>>> I attached the session below for your reference. >>>>>>> >>>>>>> Thanks, Happy Friday! >>>>>>> >>>>>>> Thank you, >>>>>>> >>>>>>> Heather Noriega >>>>>>> PhD-Pharmaceutical Science student >>>>>>> Howard University >>>>>>> heather.noriega(a)bison.howard.edu >>>>>>> 520-203-1883 >>>>>>> <nano_span_60.cxs> >>>>> >>>> <sym_2n5_copiestrue.cxs> >>>> <sym_2n3_copiestrue.cxs> >>>> <sym_2n5.cxs> >>>> <sym_2n3.cxs> >>>> <sym_both.cxs> >>>> <sym_both_copiestrue.cxs> >>>>> _______________________________________________ >>>>> ChimeraX-users mailing list -- chimerax-users(a)cgl.ucsf.edu >>>>> To unsubscribe send an email to chimerax-users-leave(a)cgl.ucsf.edu >>>>> Archives: https://mail.cgl.ucsf.edu/mailman/archives/list/chimerax-users@cgl.ucsf.edu/ >>>> >>> >> >> > >

1 0

Sequence viewer colour by B factor
by isaphan＠uw.edu 21 Jun '24

21 Jun '24

How do I colour a sequence by B factor? There's an option to 'Load a sequence coloring file'. Sounds good, but how do I produce an .scf file from a structure coloured by B-factor ? There's a format explanation, but how do I get the actual data ? Grateful for any hints.

3 2

question about coloring
by Artur Biela 21 Jun '24

21 Jun '24

dear all, I would like to color my structure (atoms) according to the LocalResolution of the map that the model is fitted in. There is a simple way to color a map according to the colors of the molecular model, but can it be done the other way around? best Artur =-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-= Artur BIELA, PhD tel: +48-518-459-652 @: artur.biela(a)uj.edu.pl [cid:ced8e93e-4e29-47d8-b709-419b04837a3b] cryoEM faciliy manager SOLARIS National Synchrotron Radiation Centre Jagiellonian University Czerwone Maki 98, 30-392 Kraków www.synchrotron.pl<http://www.synchrotron.pl/> https://synchrotron.uj.edu.pl/en_GB/linie-badawcze/cryo-em

2 1

Adjusting Torsion Angles
by Eleanor Streeper 20 Jun '24

20 Jun '24

Hi Chimera X, I hope you are well. I am a student at Swarthmore College and am currently trying to use Chimera X to adjust the torsion angles of glycans on a protein I have glycosylated. I tried using the same notation in your user guide, but the program says I am only entering 3 atom into the command bar. I attached images of the command and the numbering of those atoms (2nd entry in the angle/torsion measurement picture). I am trying to get the 2nd entry torsion to be 178.6 degrees. Can you let me know what I am doing wrong and how to adjust the torsion angle. Best, Ellie Streeper [image: Screenshot 2024-06-20 at 1.28.34 PM.png][image: Screenshot 2024-06-20 at 1.28.24 PM.png] [image: Screenshot 2024-06-20 at 1.35.46 PM.png]

2 1

Re: CHimeraX and Chimera website down
by Elaine Meng 19 Jun '24

19 Jun '24

Hi Yaikhomba, Yes, we had a planned outage for server maintenance the last few days. Usually our email is out at the same time so it will not help to send email either, sorry! There was an announcement about it to this chimerax-users email list and also a news item on the ChimeraX home page, although of course you can't see the home page when the website is down. You can change the map origin with the ChimeraX "volume" command option "origin" or "originIndex", see the help for what these mean and how to use them: <https://rbvi.ucsf.edu/chimerax/docs/user/commands/volume.html#dimensions> I hope this helps, Elaine ----- Elaine C. Meng, Ph.D. UCSF Chimera(X) team Resource for Biocomputing, Visualization, and Informatics Department of Pharmaceutical Chemistry University of California, San Francisco > On Jun 19, 2024, at 8:49 AM, M Y <yai25ram(a)gmail.com> wrote: > > Hi Elaine > > I hope you are well. > > I had trimmed the box size of a cryoEM-map using the RELION software (to 375 pixels from 600 pixels). To fit in a PDB model to the trimmed map, I also rescaled the trimmed map to 1.048 A/pixel from 1.07 A/pixel. However, these 2 maps do not overlay with one another (image attached). > > I wanted to change the origin of the trimmed map such that 2 maps overlay with one another. How could I do this in ChimeraX? > > I tried looking at the Chimera or the ChimeraX website. But, the website is either down or I am not able to access it (Screenshot attached). > > Your suggestions will be helpful. > > Many thanks > Yaikhomba > <image.png> > <image.png>

1 0

Creating bond between two selected atoms
by Eleanor Streeper 17 Jun '24

17 Jun '24

Hi Chimera X, I hope you are well. I am a student at Swarthmore College and am currently trying to use Chimera X to covalently attach glycans to asparagine residues. I was able to get 3 out of 5 of the glycans attached by selecting both atoms > structure editing > build structure > adjust bonds > add reasonable bonds. I did the same process for the other 2 glycans and no bond was made. The log says bond sel, 0 bonds. The glycans are combined with the protein using the combine command. I believed it may be an issue with an unreasonable binding distance but when I moved the glycan closer, the bond still didn't work. What else should I try? Also, do you know why it is working for some glycans but not others? Best, Ellie Streeper

2 4

Updating pdb SEQRES record with a loaded .fasta file
by Samuel Haysom 14 Jun '24

14 Jun '24

Hello, I would like to use a .fasta file that I have loaded into ChimeraX to update the SEQRES records of a PDB file that is also loaded into ChimeraX. Currently the loaded PDB file only has SEQRES records for the residues that are modelled, while the .fasta file has the full, sequence with no gaps. I have tried loading in the .fasta file and then using the $ sequence associate command to associate it with the relevant pdb chain. However, when I then save out the pdb file (using the $ save command) and then examine the pdb file it still only records the modelled residues. Is there any way to force the written pdb file to have the full sequence as uploaded in the .fasta file? I am running chimeraX version 1.7 (2023-12-19). Thanks for your help, Sam Samuel Haysom Research Scientist • Biophysics Nxera Pharma UK Limited +44 (0)1223 949201 • Steinmetz Building, Granta Park, Great Abington Cambridge, CB21 6DG, United Kingdom The information in this e-mail is confidential and may be legally privileged. It is intended for the exclusive attention of the addressee stated above and should not be copied or disclosed to any other. If you have received this transmission in error, please contact the sender immediately, make no use of its contents and delete this message from your system. Contact and registered office address: Nxera Pharma UK Limited, Granta Park, Great Abington, Cambridge, CB21 6DG. Company No: 06267989.

2 3

RBVI downtime
by Eric Pettersen 13 Jun '24

13 Jun '24

Hi all, The RBVI compute cluster will be down for scheduled maintenance Monday and Tuesday of next week (June 17/18) which means that the Chimera and ChimeraX web sites (including the ChimeraX toolshed) and mailing lists will be down during that time. This also means that web services from Chimera/ChimeraX that access our compute cluster will not work (Blast Protein, Modeller tools, sequence realignment). We are sorry for any inconvenience. --Eric Eric Pettersen UCSF Computer Graphics Lab

1 0

Resizing an ion model representation
by Ioannis Skalidis 13 Jun '24

13 Jun '24

Dear all, I want to show a metal ion surrounded by some side-chains for a figure panel, but the ion ball representation is quite small and gets lost in the figure panel. Is there a way to select only the specific ion and increase its size? I tried a bit with the "size" command, including the ballScale option but I had no luck. Any suggestions? Thanks a lot, Ioannis. Dr. Ioannis Skalidis | Structural Biochemist | Twitter: @imjohnskal <https://twitter.com/imjohnskal>

2 1

Feature Request: Visual feedback on selecting menu items
by Cam McMenamie 12 Jun '24

12 Jun '24

Hello! I'm just suggesting a UI feature that I think would be very helpful. Currently, there are several menu items that do not show any feedback if they are "selected" or not, for example, in the screenshot below (hard to tell which options have been selected / toggled). This is especially the case for mutually exclusive selections such as in the 'coloring' section in the "molecule display" tab. [cid:34830b00-bed7-4734-b191-dc4fd0fad018] Thanks in advance, Cam

2 1

Filtering PAE Contacts–Interfaces
by David S. Fay 10 Jun '24

10 Jun '24

Hi, Was attempting (unsuccessfully) to filter out lower scoring (red/yellow) PAE contacts when viewing interaction interfaces between two or more proteins. I normally use a command such as: alphafold contacts /A to /B distance 5 But then I’d like to limit what I see to regions with high pLDDT scores (blue lines). I tried playing with range, but keep getting errors. Thanks! David

3 3

Animate RELION jobs
by James Hooker 10 Jun '24

10 Jun '24

Hi all, Is there an easy way to generate animations of RELION classification jobs in ChimeraX? I came across https://github.com/Stefan-Zukin/relionReport, but haven’t been able to get it to work. Best, James James Hooker jhooker(a)mrc-lmb.cam.ac.uk PhD candidate Löwe group, Structural Studies division MRC Lab of Molecular Biology Cambridge, United Kingdom

2 1

Re: [Chimera-users] ChimeraX_InfoRequest
by Elaine Meng 10 Jun '24

10 Jun '24

Hello Dr. Altan Kara, Resolution is just the number of pixels width and height. To get higher resolution, specify larger numbers for the pixel width and height in the save image options (GUI or save command). Chimera has a separate setting for physical size (e.g. inches or cm) and then the pixels per physical size unit (dpi), but the result is still the total number of pixels. For example 2 inches wide with 600 pixels/inch is 1200 pixels wide. ChimeraX does not have separate settings for the physical size. For the same example, in ChimeraX you would just choose 1200 pixels wide. The result will not be marked with a physical size, however. You would have to use some other program like Photoshop if you want to mark it as 2 inches wide. If you know the physical size you want and the resolution at that size, just calculate the total pixel width and height and enter that when you save the image. For the future, if you want to ask a ChimeraX question it is better to use the ChimeraX email address: chimerax-users(a)cgl.ucsf.edu I hope this helps, Elaine ----- Elaine C. Meng, Ph.D. UCSF Chimera(X) team Resource for Biocomputing, Visualization, and Informatics Department of Pharmaceutical Chemistry University of California, San Francisco > On Jun 7, 2024, at 5:17 AM, Altan KARA (MAM-GMBE) via Chimera-users <chimera-users(a)cgl.ucsf.edu> wrote: > > To whom it may concern, > > How we can create high resolution images with ChimeraX? > No matter what I tried still the outputted images are not in high resolution.

2 2

ChimeraX segfaults when left on loop to make movies/images
by Artie Kushner 07 Jun '24

07 Jun '24

Hi, I hope the summer is starting off really well for you. tldr: I leave ChimeraX running movie/image generating commands from a python script in a tmux session and it segfaults on multiple machines. I was wondering if someone has encountered this before or can lend advice as to why this happens. I'd like to produce some movies (or at least pictures) in bulk (around 2000 individual molecules). I preprocess each one (load locally or open, add some representation, and either start recording a movie or "save XXXX.png"). After about 8-10 successful movies or images are produced I get a ChimeraX segfault and the process dies. This is quite perplexing to me because - I tried it on multiple machines: Ubuntu 22.04, installed from the .deb <https://www.cgl.ucsf.edu/chimerax/download.html> and Arch, installed from aur distribution. - both with `--offscreen` and `--nogui` flags and without them ( in fact, following up some threads in the mailing list it seems like it's not possible to produce movies with --nogui, just pngs) - there seems to be *no* excessive memory or page cache issues, although i haven't profiled it. Only one core is occupied when rendering both mp4/png's. Below I'm attaching a crash log from one of the machines (Ubuntu 22.04) and the description of my setup, which is a little awkward, but I don't think it's the cause since it produces some samples successfully before crashing. I hope i'm wrong. Best regards and any tips are really appreciated! I was really looking forward to having some crisp images. --------------------------------------------------------------------------------------- I start the process by calling a python script at the command line: ` chimerax --script "/home/student/dev/riboxyz/chimerax/ribrepr.py" --nogui --offscreen` when i tried generated images. This was after I gave up on getting the movies, which i did by just opening a ChimeraX gui on our workstation and calling a "loop.py" after a load the commands from "ribrepr.py" file from the gui command line. I do both in a tmux session. ```loop.py import os from chimerax.core.commands import run from concurrent.futures import ThreadPoolExecutor *DEST_DIR* = "/home/rtviii/dev/riboxyz/chimerax/movies" # This expands to ~1800 PDB ids: rcsb_id:= {4UG0, 7K00 and so on} for rcsb_id in os.listdir('/home/rtviii/dev/RIBETL_DATA'): movie_dir = os.path.join(DEST_DIR, "{}.mp4".format(rcsb_id)) print("Attempting to write ", movie_dir) if "{}.mp4".format(rcsb_id) in os.listdir(DEST_DIR): print("Skipping {}. Exists".format(rcsb_id)) continue else: run(session,"ribmovie {}".format(rcsb_id)) # <---- ribmovie command corresponds to the `*produce_and_save_movie*` in ribrepr.py below ``` The contents of the `ribrepr.py` are just to register a command for custom visualization of a given molecule + loop over molecules for image generation. ``` ribrepr.py import enum import json import os import sys from chimerax.core.commands import register, CmdDesc from chimerax.atomic import ResiduesArg, Chains, ChainArg, StructureArg from chimerax.atomic import Structure, AtomicStructure, Chain from chimerax.core.commands import run, runscript from chimerax.core.commands import CmdDesc, register, StringArg # https://mail.cgl.ucsf.edu/mailman/archives/list/chimera-users@cgl.ucsf.edu/… # just a data folder, it exists. *RIBETL_DATA* = os.environ.get("RIBETL_DATA", "/home/rtviii/dev/RIBETL_DATA") class *PolymerClass*(str, enum.Enum): tRNA = "tRNA" bS1m = "bS1m" # ... another ~200 enum members, redacted for brevity CHIMERAX_COLORS = [ ["tan", "#d2b48c"], ["sienna", "#a0522d"], #... more colors redacted for brevity ] # helper function to map colors def *get_polymer_color*(polymer_class:str): polyix = list(map(lambda x: x.value, (PolymerClass))) class_index = polyix.index(polymer_class) % len(polyix) if polymer_class == None: return "gray" return CHIMERAX_COLORS[(class_index % len(CHIMERAX_COLORS))][1] def *ribosome_representation*(session, structure: AtomicStructure): for _ in list(PolymerClass): print(_.name) from chimerax.core.commands import run from chimerax.core.colors import hex_color from chimerax.atomic import Residue, Atom, Chain # i get the PDB ID from the StructureArg rcsb_id = str(structure.name).upper().split('.')[0] # <-- the structure gets opened with the basename ex "(5AFI.cif)" run(session, "set bgColor white") run(session, "sym #1 assembly 1") # take only one assembly if multiple are available run(session, "hide #2") with open(os.path.join(RIBETL_DATA, rcsb_id, "{}.json".format(rcsb_id)), "r") as f: profile = json.load(f) # load my annotations, just a json file #--------------------------------------------[ This whole bit just colors by chain annotation basically] polymers = {} polymer_chains = [ *profile["proteins"], *profile["rnas"], *profile["other_polymers"], ] [ polymers.update(x) for x in [{chain["auth_asym_id"]: chain} for chain in polymer_chains] ] c: Chain for c in structure.chains: aaid = c.chain_id polyclass = None if len(polymers[aaid]["nomenclature"]) < 1: continue else: polyclass = polymers[aaid]["nomenclature"][0] if polymers[aaid]["entity_poly_polymer_type"] == "RNA": run(session, "surf /{}".format(aaid)) run(session, "transp /{} 100".format(aaid)) run(session, "color /{} gray".format(aaid)) else: run(session, "show /{} cartoon".format(aaid, get_polymer_color(polyclass))) run(session, "color /{} {}".format(aaid, get_polymer_color(polyclass))) #--------------------------------------------[ This whole bit just colors by chain annotation basically] run(session, "graphics silhouettes true width 1") run(session, "light soft") # # ! Didn't work out for now. This is how i tried to make movies. (Loop over every structure (loop.py above) and call this command). Chimerax segfaults when looped on this. # def *produce_and_save_movie*(session, target:str): # print("GOT TARGET", target) # RCSB_ID = target # run(session, "open /home/rtviii/dev/RIBETL_DATA/{}/{}.cif".format(RCSB_ID, RCSB_ID)) # run(session, "sym #1 assembly 1") # take only one assembly if multiple are available # run(session, "ribrep #2") # run(session, "movie record") # run(session, "turn y 2 180") # run(session, "wait 180") # run(session, "movie encode /home/rtviii/dev/riboxyz/chimerax/movies/{}.mp4".format(RCSB_ID)) # run(session, "close all") # # ! This is just to not download the mmcif files i have locally. def *register_ribetl_command*(logger): def ribetl(session, rcsb_id:str): rcsb_id = rcsb_id.upper() run(session, "open /home/rtviii/dev/RIBETL_DATA/{}/{}.cif".format(rcsb_id, rcsb_id)) desc = CmdDesc( required= [("rcsb_id", StringArg)], ) register("ribetl", desc, ribetl, logger=logger) # # ! Register the above repr sequence as a command. def *register_ribrepr_command*(logger): from chimerax.core.commands import CmdDesc, register from chimerax.atomic import AtomicStructureArg, Chain, Residue, Atom desc = CmdDesc( required = [("structure", AtomicStructureArg)], required_arguments = ["structure"], synopsis = "representation ", ) register("ribrep", desc, ribosome_representation, logger=logger) *register_ribrepr_command*(session.logger) *register_ribetl_command*(session.logger) # This loop expands into a list of ~1800 PDB : 5AFI, 4UG0 and so on. for rcsb_id in os.listdir(RIBETL_DATA): run(session,"open {}".format(rcsb_id)) run(session,"ribrep #1") run(session,"save /home/student/dev/riboxyz/chimerax/{}.png width 800 height 800 transparentBackgroun d true".format(rcsb_id)) run(session,"close all") ``` Let me know if i can elucidate this situation further with hardware specs or whatnot. I'm quite at loss as to how to proceed with this.

2 2

Alpha fold not responding
by Cao,JingJing 07 Jun '24

07 Jun '24

Hello, I was using the program to run Alphafold prediction, it’s keep giving me error messages (502): The server encountered a temporary error and could not complete your request. Please try again in 30 seconds. That’s all we know. How to solve this problem? Thanks, JingJing The information contained in this e-mail message may be privileged, confidential, and/or protected from disclosure. This e-mail message may contain protected health information (PHI); dissemination of PHI should comply with applicable federal and state laws. If you are not the intended recipient, or an authorized representative of the intended recipient, any further review, disclosure, use, dissemination, distribution, or copying of this message or any attachment (or the information contained therein) is strictly prohibited. If you think that you have received this e-mail message in error, please notify the sender by return e-mail and delete all references to it and its contents from your systems.

2 1

Modifying the transparency of a specific region within a single map
by 张楠 07 Jun '24

07 Jun '24

Dear developers, How can I change the transparency of a specific region within a single map, similar to what is shown in the attached image? Is this possible to do in ChimeraX?" Looking forward to your answer, thank you！ Best regards, Nan zhangnan(a)nankai.edu.cn

3 2

Renaming of "Non-standard residues" upon file opening
by Mikkel Dahl Andreasen 07 Jun '24

07 Jun '24

Hello I have a question regarding ChimeraX renaming residues upon loading pdb files. I am specifically referring to a pdb file containing the following lines: TITLE PLACEHOLDER_TITLE REMARK PLACEHOLDER_REMARK CRYST1 100.000 100.000 100.000 90.00 90.00 90.00 P 1 1 MODEL 1 ATOM 1 NC3 DOPCA 1 93.725 50.146 69.265 1.00 0.00 ATOM 2 PO4 DOPCA 1 93.471 50.284 66.361 1.00 0.00 ATOM 3 GL1 DOPCA 1 93.591 50.038 63.469 1.00 0.00 ATOM 4 GL2 DOPCA 1 94.818 50.396 63.498 1.00 0.00 ATOM 5 C1A DOPCA 1 93.669 50.374 60.367 1.00 0.00 ATOM 6 D2A DOPCA 1 93.738 49.939 57.365 1.00 0.00 ATOM 7 C3A DOPCA 1 93.390 49.936 54.359 1.00 0.00 ATOM 8 C4A DOPCA 1 93.358 50.194 51.480 1.00 0.00 ATOM 9 C1B DOPCA 1 96.261 50.393 60.395 1.00 0.00 ATOM 10 D2B DOPCA 1 96.060 50.114 57.261 1.00 0.00 ATOM 11 C3B DOPCA 1 96.224 50.032 54.669 1.00 0.00 ATOM 12 C4B DOPCA 1 95.844 50.135 51.528 1.00 0.00 TER END When I load this file into ChimeraX using "open file.pdb" it renames the residue name "DOPC" to "DOP". A table appears in the Log regarding "Non-standard residues in file.pdb" wherein it lists "DOP - (DOP)" without mentioning "DOPC". However, when I open another file which contains many different types of molecules, then it does not rename "DOPC" to "DOP", even though the "Non-standard residues in file.pdb" table also appears, though this time with an entry containing "DOPC - (DOPC)". I have also previously experienced that ChimeraX renames some (not all) of my cholesterol molecules to "CHO" (instead of using the actual residue name which is "CHOL"). I had a look through the documentation for the "open" command, but I couldn't find anything useful about it. I was wondering why this is happening and if there is a way to prevent it. And just so i am clear, by prevent I don't mean revert (e.g. rename them back to "DOPC" after loading), but actually preventing the initial renaming done by ChimeraX. Kind regards, Mikkel Dahl Andreasen

3 3

modeller fails in chimerax RC-1.8
by Roberto Marabini 06 Jun '24

06 Jun '24

Hi, I just installed chimerax RC-1.8 and tried to use "modeller" (tools->sequence->modeller comparative). The resulting error message is attached to this email. If I use chimerax 1.7 with the very same data modeller works. Am I doing something wrong or did I find a bug? cheers Roberto Follows the complete log: === modeller comparative aligned_1.fasta:2 numModels 5 fast false multichain false hetPreserve true hydrogens false waterPreserve falseWebservices job id: GN1G33GHX39IPCAE Modeller job (ID GN1G33GHX39IPCAE) finished Modeller error output Traceback (most recent call last): File "ModellerModelling.py", line 74, in <module> a.make() File "/usr/lib64/python3.8/site-packages/modeller/automodel/automodel.py", line 141, in make self.homcsr(exit_stage) File "/usr/lib64/python3.8/site-packages/modeller/automodel/automodel.py", line 624, in homcsr self.check_alignment(aln) File "/usr/lib64/python3.8/site-packages/modeller/automodel/automodel.py", line 577, in check_alignment aln.check() File "/usr/lib64/python3.8/site-packages/modeller/alignment.py", line 213, in check self.check_structure_structure(io=io) File "/usr/lib64/python3.8/site-packages/modeller/alignment.py", line 222, in check_structure_structure return f(self.modpt, io.modpt, self.env.libs.modpt, eqvdst) _modeller.SequenceMismatchError: read_te_291E> Sequence difference between alignment and pdb : Modeller run output MODELLER 10.5, 2024/01/19, r12711 PROTEIN STRUCTURE MODELLING BY SATISFACTION OF SPATIAL RESTRAINTS Copyright(c) 1989-2024 Andrej Sali All Rights Reserved Written by A. Sali with help from B. Webb, M.S. Madhusudhan, M-Y. Shen, G.Q. Dong, M.A. Marti-Renom, N. Eswar, F. Alber, M. Topf, B. Oliva, A. Fiser, R. Sanchez, B. Yerkovich, A. Badretdinov, F. Melo, J.P. Overington, E. Feyfant University of California, San Francisco, USA Rockefeller University, New York, USA Harvard University, Cambridge, USA Imperial Cancer Research Fund, London, UK Birkbeck College, University of London, London, UK Kind, OS, HostName, Kernel, Processor: 4, Linux wilkins.cgl.ucsf.edu 4.18.0-513.24.1.el8_9.x86_64 x86_64 Date and time of compilation : 2024/01/20 00:40:16 MODELLER executable type : x86_64-intel8 Job starting time (YY/MM/DD HH:MM:SS): 2024/06/06 03:33:20 environ____W> The class 'environ' is deprecated; use 'Environ' instead openf___224_> Open $(LIB)/restyp.lib openf___224_> Open ${MODINSTALL10v5}/modlib/resgrp.lib rdresgr_266_> Number of residue groups: 2 openf___224_> Open ${MODINSTALL10v5}/modlib/sstruc.lib Dynamically allocated memory at amaxlibraries [B,KiB,MiB]: 191566 187.076 0.183 Dynamically allocated memory at amaxlibraries [B,KiB,MiB]: 192094 187.592 0.183 openf___224_> Open ${MODINSTALL10v5}/modlib/resdih.lib Dynamically allocated memory at amaxlibraries [B,KiB,MiB]: 240694 235.053 0.230 rdrdih__263_> Number of dihedral angle types : 9 Maximal number of dihedral angle optima: 3 Dihedral angle names : Alph Phi Psi Omeg chi1 chi2 chi3 chi4 chi5 openf___224_> Open ${MODINSTALL10v5}/modlib/radii.lib Dynamically allocated memory at amaxlibraries [B,KiB,MiB]: 253994 248.041 0.242 openf___224_> Open ${MODINSTALL10v5}/modlib/af_mnchdef.lib rdwilmo_274_> Mainchain residue conformation classes: APBLE openf___224_> Open ${MODINSTALL10v5}/modlib/mnch.lib rdclass_257_> Number of classes: 5 openf___224_> Open ${MODINSTALL10v5}/modlib/mnch1.lib openf___224_> Open ${MODINSTALL10v5}/modlib/mnch2.lib openf___224_> Open ${MODINSTALL10v5}/modlib/mnch3.lib openf___224_> Open ${MODINSTALL10v5}/modlib/xs4.mat rdrrwgh_268_> Number of residue types: 21 automodel__W> The class 'automodel' is deprecated; use 'AutoModel' instead openf___224_> Open alignment.ali Dynamically allocated memory at amaxalignment [B,KiB,MiB]: 282425 275.806 0.269 Dynamically allocated memory at amaxalignment [B,KiB,MiB]: 297517 290.544 0.284 Dynamically allocated memory at amaxalignment [B,KiB,MiB]: 312917 305.583 0.298 Dynamically allocated memory at amaxalignment [B,KiB,MiB]: 343717 335.661 0.328 Dynamically allocated memory at amaxsequence [B,KiB,MiB]: 344285 336.216 0.328 read_te_291E> Sequence difference between alignment and pdb : x (mismatch at alignment position 1) Alignment XSLSDKDKAAVRALWSKIGKSADAIGNDALSRMIVVYPQTKTYFSHWPDVTPGSP PDB SLSDKDKAAVRALWSKIGKSADAIGNDALSRMIVVYPQTKTYFSHWPDVTPGSPH Match * * Alignment residue type 24 (X, UNK) does not match pdb residue type 16 (S, SER), for align code 1pbx.cif_2/A (atom file 1pbx.cif_2), pdb residue number " 1", chain "A" Please check your alignment file header to be sure you correctly specified the starting and ending residue numbers and chains. The alignment sequence must match that from the atom file exactly. Another possibility is that some residues in the atom file are missing, perhaps because they could not be resolved experimentally. (Note that Modeller reads only the ATOM and HETATM records in PDB, NOT the SEQRES records.) In this case, simply replace the section of your alignment corresponding to these missing residues with gaps. read_te_288W> Protein not accepted: 1 1pbx.cif_2/A No output models from Modeller; see log for Modeller text output.

3 3

Converting a carbonyl group to carboxylic acid group
by Prathvi Singh 06 Jun '24

06 Jun '24

Hi Elaine, I have a SER residue which is in the middle of a polypeptide chain. Is there a way in chimera/chimeraX to specifically extract this residue such that the carbonyl group bonded to its N-terminal NH group also gets extracted but is converted to carboxylic acid group (-COOH group) before extracting? Thanks in advance, Prathvi Singh, Research Fellow, Department of Biological Sciences & Bioengineering, Indian Institute of Technology, Kanpur-208016

2 4

Molecule_to_sphere
by Noriega, Heather 05 Jun '24

05 Jun '24

Hello, I hope this email finds you well. I have a molecule that I created through the build feature in Chimera, and what I would like to do is just create a sphere of as many copies as it can fit to see the estimated encapsulation volume. However, there is no symmetry assembly to use the matchmaker and I was trying to use the sym command, but it isn't even recognizing the command. sym #1 i,222 sym #1 i, n25 Sym#1 i, 222r I have tried others with the center command, and I also tried to add copies false NewModel true at the end. What am I plugging in wrong? The molecule is saved as a pdb, and uploads no issue on ChimeraX. Thank you, Heather Noriega PhD-Pharmaceutical Science student Howard University heather.noriega(a)bison.howard.edu 520-203-1883

2 4

Push and pulling model/map towards/away
by Pranav Shah 05 Jun '24

05 Jun '24

Hi Team, Chimera used to have a really nice feature that allowed for a model to be pushed away or pulled towards the user. How do I access this feature in ChimeraX? Best, Pranav -- Pranav Shah Postdoctoral Research Fellow. Division of Structural Biology, Wellcome Trust Centre for Human Genetics, University of Oxford, Roosevelt Drive, Oxford OX3 7BN, UK

3 8

Selecting the N or C-terminus of every chain in a PDB file
by André Graça 05 Jun '24

05 Jun '24

Hi everyone! I could not figure this one out just yet, but it might be easy (?): I am interested to make a quick selection that targets the first or last atom of all the chains present in a given PDB file. /André Graça

2 1

Fetch many pdbs/maps from the pdb-redo?
by Francisco Murphy Pérez 05 Jun '24

05 Jun '24

Dear all I thought this was going to work, `open "1iee, 2blx, 2bly" fromDatabase redo format mmcif`... but it does not. I have many more ids that I want to open... Can I fetch them all with a single command? Thanks

2 2

Morph command for protein-ligand complexes
by Enrico Martinez 05 Jun '24

05 Jun '24

Dear ChimeraX users! I have a question about recording movie with the transitions between different conformations using morph command. Having five conformations for the same protein, after its supermpostiion using mm #2-5 to #1 I generated a trajectory with the transition using: morph #2,3,4,5,6 core 0.1 frames 100 wrap f rate linear And then recorded movie using: # start recording movie record size 3840,2160 supersample 1 coordset #7 1,400,1 computeSs true wait 400 My question is about morph command. Assuming that all 5 models are very well superimposed and the difference is only the bound ligand (which is different in every model!), would it be possible to include these different ligands in the final morphed trajectory, thus making a smooth transition between different binding poses ? Many thanks in advance ! Enrico

2 2

How to reproduce the output of "info" in python script?
by Artie Kushner 04 Jun '24

04 Jun '24

Hi there, hope you are all doing well I'm wondering if anyone has a good idea of how to reproduce the output of the *info* command in the GUI inside a python script. Precisely the *info* command without any specifiers s.t. that all models and submodels are listed with minimal info. Like the following: *...#1.87, 4v6x Cu, shown419 atoms, 421 bonds, 56 residues, 1 chains (Cu)#1.88, 4v6x Cv, shown419 atoms, 421 bonds, 56 residues, 1 chains (Cv)#1.89, 4v6x Cz, shown1741 atoms, 1769 bonds, 217 residues, 1 chains (Cz)* Perhaps there is a better way to do this, but my use case is splitting a bigger structure into multiple chains (as you can tell from above there are 89 chains in 4V6X). I'd like to be able to correlate chain IDs (ex. *Cz*) with the model identifiers (ex. *#1.89*) programmatically from within python to script against individual chains further. I'm sure there is more than one way to do it, but i haven't been able to find either so far. Most that i found is the model_info command: *from chimerax.list_info.util import spec, model_info...def test_func(session, structure: AtomicStructure): print(model_info(structure))**<<<Missing or invalid "structure" argument: must specify 1 atomic structure, got 89 for "#1".* *def register_ribrepr_command(logger): from chimerax.core.commands import CmdDesc, register from chimerax.atomic import AtomicStructureArg, Chain, Residue, Atom desc = CmdDesc( required = [("structure", AtomicStructureArg)], required_arguments = ["structure"], synopsis = "representation ", ) register("test_func", desc, test_func, logger=logger)* but it presupposes that I pass the model by spec I pass the "top-level" structure. It throws error saying that it contains 89 instead of 1 structures: *Missing or invalid "structure" argument: must specify 1 atomic structure, got 89 for "#1".* Any other way of getting at the correspondence dict between chains/"submodels" created with i.e. *`split chains`* and their chain_id's (aka *auth_asym_id* 's) in Python space would work for me. Perhaps there is a way to list all objects in the "Models" section (picture below)? Thanks in advance Artie [image: image.png]

2 2

Question/ GPCR complex
by Ranti Dev Shukla 03 Jun '24

03 Jun '24

Hello, Greetings from NIH, Maryland. I am trying to make FRET for G-proteins. I put CFP protein within G.alfa2 on a loop between two nearby helixes and YFP protein on the N-terminal of G-beta. I made the complex using Alphafold but how to see this complex along with the membrane? Is there some command for it please? I would appreciate your kind help. Thanks Ranti Best wishes, Ranti Dev Shukla Visiting Fellow, NIH, Rockville, MD Email: rantibio2(a)gmail.com *rantibio3(a)gmail.com <rantibio3(a)gmail.com>* Phone: +1 865-910-2985 *Teachers* make a lasting impact in the lives of their students

2 1

Rotation of the multi-model object using the symmetric axis
by Enrico Martinez 03 Jun '24

03 Jun '24

Dear Chimera-X users! I am dealing with the visualisation of a complex dimer where each monomer is defined as a separate model like #1 and #2. For visualisation purposes I need to rotate the input construct by 180 degrees with the axis of rotation in the middle between the two monomers to avoid the shift of the complex in the x-plane at the end. That's what I have tried: # turn on 180 deg during 10 sec roll y 0.72 250 center #1,2 protein wait 250 but the construct still shifted a bit towards one of the monomers. How could I do ii using the rotation axis, which would be in the center between them ? Many thanks in advance Enrico

3 4

Conversion of multiple files into PDB
by Enrico Martinez 03 Jun '24

03 Jun '24

Dear ChimeraX Users ! I am dealing with the analysis of multiple structural coordinates generated by AlphaFold for a target protein in *.cif extension. My goal is superimpose all the coordinates to the first model and save them in .pdb as separate files. So my script could be: open ./*.cif match #2-6 to #1 # probably there is a better solution # and some command for save What could be the solution to save all the coordinates in automatic way in separate pdb with the name patterns corresponded to the ID of these models ? Many thanks in advance Enrico

3 3

attributes from viewdockx.
by Krishnan Raman 31 May '24

31 May '24

Hi guys, * Make ViewDockX table information available as model attributes<https://rbvi.github.io/chimerax-recipes/vdx_attrs/vdx_attrs.html>. December 17, 2021 Used this Py to register my attributes into chimerax. Is there a way to display the attributes next to the model of the ligand? Thanks Krish Krishnan Raman Executive Director, Structural Biology BioCryst Pharmaceuticals CONFIDENTIALITY NOTICE This email, including any attachments, may contain confidential or legally privileged information that is intended only for the individual or entity to whom it is addressed. If you are not the intended recipient, please be advised that any dissemination, distribution or copying of this email and any attachment is strictly prohibited. If you have received this email in error, please reply to the sender so that BioCryst Pharmaceuticals, Inc. can take corrective measures and then permanently delete this email and any attachment, including any printed copies. Thank you.

2 5

Grid mode for multiple superimposed models
by Enrico Martinez 31 May '24

31 May '24

Dear ChimeraX users ! I am working on the structural analysis of the predictions of the alpha fold loaded in Chimera as different models. Do we have an option that would allow us to take each model as an element of the grid so that the superimposed models could be displayed side by side (e.g. in one row for 1-3 models or in 2 rows for 4-6 models etc)? I've seen this option in P*mol, but would like to try it in ChimeraX if it exists! Many thanks in advance Enrico

2 2

ChimeraX question
by Meden Isaac-Lam 30 May '24

30 May '24

Hello UCSF Chimera Team, I used Chimera and AutoDock Vina about 2 years ago. I just downloaded ChimeraX and I am trying to learn it. However, I forgot how to link AutoDock Vina. In the previous Chimera, it was under Tools and Surface Binding Analysis. Any suggestion on how to do it? Thanks. Your assistance is greatly appreciated. Sincerely, Meden F. Isaac-Lam Purdue University Northwest

2 2

Error installing bundle: No module named pandas
by Ricardo Righetto 29 May '24

29 May '24

Hi, Not sure if this should be reported here or to the bundle developers directly, but in any case here it goes: When trying to install the ArtiaX plugin on ChimeraX v1.7.1 on Ubuntu 22.04 from the toolshed (both via command line and through the GUI) I ran into the following error: *** error: subprocess-exited-with-error × python setup.py egg*info did not run successfully. │ exit code: 1 ╰─> [10 lines of output] Traceback (most recent call last): File "", line 2, in File "", line 34, in File "/tmp/pip-install-ni7khioh/starfileddcd2480b29b4cad9233c413b6568ba0/setup.py", line 2, in from starfile.version import VERSION File "/tmp/pip-install-ni7khioh/starfile_ddcd2480b29b4cad9233c413b6568ba0/starfile/__init* .py", line 1, in from .functions import open, read, new, write, version, star2excel File "/tmp/pip-install-ni7khioh/starfile _ddcd2480b29b4cad9233c413b6568ba0/starfile/functions.py", line 3, in import pandas as pd ModuleNotFoundError: No module named 'pandas' [end of output] note: This error originates from a subprocess, and is likely not a problem with pip. error: metadata-generation-failed × Encountered error while generating package metadata. ╰─> See above for output. note: This is an issue with the package mentioned above, not pip. hint: See above for details . *** That is, it was complaining that the pandas package was missing when trying to install the starfile package, which in turn is a dependency of ArtiaX. I'm puzzled why it wasn't able to install pandas by itself, since it is listed as a dependency of starfile. Anyway, after trying many different things, I found out that I could install pandas via pip directly through the ChimeraX command line interface: pip install pandas And after that the bundle installation worked just fine. Not sure what to make of this, but maybe it's useful to developers or other users running into the same issue. Thank you, -- Ricardo Diogo Righetto

1 0

Question Regarding rangecolor kdHydrophobic command
by Knotts, Garrett 29 May '24

29 May '24

Good morning, I am in the process of switching over from Chimera to ChimeraX. I have found ChimeraX to be incredibly more user friendly and well-designed. I wanted to reach out regarding the rangecolor kdHydrophobic command. I often use this command in chimera to color protein surfaces based on hydrophobic character. However, we have a color scheme which our lab has consistently used. In the switch from Chimera to ChimeraX, I have not found a way to color by hydrophobicity with our color scheme using this or other commands, but I have found a way to color hydrophobic regions onto surfaces, without the ability to change the colors. Is there a way to do this in ChimeraX? Thanks for the help! Best, _______________________________ Garrett Knotts Undergraduate Lab Assistant (Johnson Lab) Legislative Director of the Mississippi State University Student Association Vice President of Honors Ambassadors Sigma Phi Epsilon Learning Community Coordinator [cid:8783bc97-b3f7-4f42-85c5-130c16ad956f]

2 1

Behavior of "cd" when executed through a script
by Vorländer,Matthias Kopano 29 May '24

29 May '24

Dear ChimeraX team, I have a series of scripts that contain a “cd” statement to set the working directory. I execute the scripts (which opens a model and map and colors the map). I then manually adjust the orientation and threshold and want to save a picture with “save map.png” (I want this png tp be saved in the folder that I set with the script). I have noticed that in this scenario ChimeraX has “forgotten” the cd statement from the script file and has fallen back to default working directory (or the last working directory manually set in the session before I exectuted my script). At least for me it would be more convenient and logical if the working directory can be set and maintained after habing executed a script. Note: if I don’t execute the script by double clicking but by copy/paste, the working directory is correctly maintained. Would be great if the behavior could be adjusted 😊 Many thanks and best wishes, Matthias

2 3

Command not found from cxc file v1.7.1 on M2 Mac
by Hong Glenn Meng ZHAN 29 May '24

29 May '24

Evening all, I was trying to color code my imod models based on their volume (see attached). It worked ok for me just one model file opened in ChimeraX. When I was doing anther model file, I can passed the individual command in the command line to change color: color #1.1 #ceecc8 However, when I generate a cxc file and open it from command line or click on Open, it showed Unknown command: color #1.1 #ceecc8 Any input where I was not doing correctly? Thanks for helping! -Hong [Screenshot 2024-05-28 at 11.22.11 PM.png][image2.png]

2 2

Python scripting for Dipole moment calculation
by andreumormaldon＠outlook.com 28 May '24

28 May '24

Hi all! I am trying to calculate the dipole moment of different proteins at different pH values. The .pdb and .dx files are generated with pdb2pqr and apbs software. I have found a script that is written for chimera, but it seems that the modules are not translated to ChimeraX, or at least I am not able to make it work. So I have decided to try to write my own script. So far I am able to obtain the center of mass of the protein as well as the charges of all the atoms in the molecule, but I cannot find a way to build a vector to where calculate the dipole (as it is done in the chimera script). Can anyone give me some insights? Does ChimeraX have as well the class Vector and Point? Thank you very much for your help! Best, Andreu

2 1