- ChimeraX-users - RBVI Mailing Lists

ChimeraX depthCue
by Gokhan Tolun 18 Aug '20

18 Aug '20

Hi, Based on here: https://www.rbvi.ucsf.edu/chimerax/docs/user/commands/lighting.html I am trying to adjust the depth cue using the depthCue true | false depthCueColor color-spec depthCueStart start depthCueEnd end commands, but I get the error Unknown command: Any suggestions? Thanks, Gökhan PS: ChimeraX 1.0

2 2

Oculus quest for chimeraX?
by Miriam Díaz Galicia 18 Aug '20

18 Aug '20

Dear chimeraX users I would like to buy my first VR headset to use with ChimeraX. I am considering buying the Oculus quest but I would like to confirm that it will properly work for ChimeraX. Has anyone used it? or is there a better low-cost VR headset (preferably but not limited to all-in-one devices) that you can recommend to me? Thank you very much in advance, Escarlet -- This message and its contents, including attachments are intended solely for the original recipient. If you are not the intended recipient or have received this message in error, please notify me immediately and delete this message from your computer system. Any unauthorized use or distribution is prohibited. Please consider the environment before printing this email.

3 8

Draw a circle
by Andrea Dallapè 18 Aug '20

18 Aug '20

Hi, I would like to highlight a hole in a protein -the exit tunnel of a ribosome, to be more specific. I tried the command shape tube in order to draw three tubes passing through three residues, but the result doesn't suit at best my need and expectations. Is possible to draw a circle, passing through three points -or residues-? Do you have any suggestions? Thank you for your attention. Have a great week end. Greetings, Andrea

2 5

Re: [chimerax-users] [Chimera-users] [External] Re: The command like volume zone in X
by Tom Goddard 14 Aug '20

14 Aug '20

Hi Fengwei, I added the "wobble" command to ChimeraX today that makes a figure 8 motion. It will be in tonight's ChimeraX builds -- nightly builds are listed at the bottom of the downloads web page. The wobble command is just a shorthand for the turn command and the turn command now has two new options: wobble that controls speed and is the number of frames for a complete figure 8, and wobbleAspect that controls the amplitude of the bobbing motion as a fraction of the side to side motion (default 0.3). The wobble command uses a default cycle of 136 frames per second which at 60 frames/second rendering is a little more than 2 seconds per figure 8. The wobble command makes the default amplitude 15 degrees. Tom > On Aug 14, 2020, at 9:37 AM, Zheng, Fengwei wrote: > > Dear Elaine, > > Got it, Thank you so much for your kind explanation! Stay safe and Have a great weekend! > > Best, > Fengwei > From: Elaine Meng > Sent: Friday, August 14, 2020 12:34 > To: Zheng, Fengwei > Cc: chimera-users(a)cgl.ucsf.edu <mailto:chimera-users@cgl.ucsf.edu> <chimera-users(a)cgl.ucsf.edu <mailto:chimera-users@cgl.ucsf.edu>> > Subject: [External] Re: [Chimera-users] The command like volume zone in X > > Hi Fengwei, > There is a "vop zone" command in Chimera similar to "volume zone" in ChimeraX. Same function, but the keywords and syntax are different, see > > <http://www.rbvi.ucsf.edu/chimera/docs/UsersGuide/midas/vop.html#zone <http://www.rbvi.ucsf.edu/chimera/docs/UsersGuide/midas/vop.html#zone>> > > E.g. something like: > > vop zone #2 #0:.a 2 > > As for your other question, Chimera has a "precessionTilt" option to the "roll" command, but ChimeraX does not have this option currently. Looking at this kind of motion makes me feel seasick, so I don't use it in my own work. > > <http://www.rbvi.ucsf.edu/chimera/docs/UsersGuide/midas/roll.html <http://www.rbvi.ucsf.edu/chimera/docs/UsersGuide/midas/roll.html>> > > I hope this helps, > Elaine > ----- > Elaine C. Meng, Ph.D. > UCSF Chimera(X) team > Department of Pharmaceutical Chemistry > University of California, San Francisco > > > On Aug 14, 2020, at 8:43 AM, Zheng, Fengwei wrote: > > > > Dear Developer, > > I am wodering if there is a command of Chimera can achieve the same function like "volume zone" in ChimeraX? I tried the command "vol zone #2 near #0:.a range 2", but the chimera always said "unknow keyword #2"~ > > Another thing is that I wonder if there is a command of ChimeraX can achieve the same function like "turn z 2 360 precess 20" in Chimera (to achieve the Wobble motion / "wiggle-rock" motion, like nutation in pymol)~ > > The I tried 1.14, 1.15 and the latest daily built versions of Chimera. > > The ChimeraX version I used is 1.0, Many thanks! > > Best, > > Fengwei > > CAUTION: This email was sent from outside of the organization (meng(a)cgl.ucsf.edu <mailto:meng@cgl.ucsf.edu>). Do not click links or open attachments unless you recognize the sender and know the content is safe. If you have any questions, please contact ServiceDesk(a)vai.org <mailto:ServiceDesk@vai.org> <mailto:servicedesk@vai.org <mailto:servicedesk@vai.org>>. > > _______________________________________________ > Chimera-users mailing list: Chimera-users(a)cgl.ucsf.edu <mailto:Chimera-users@cgl.ucsf.edu> > Manage subscription: https://www.rbvi.ucsf.edu/mailman/listinfo/chimera-users <https://www.rbvi.ucsf.edu/mailman/listinfo/chimera-users>

2 1

Discrete coloring and secondary structure assignment.
by Reza Khayat 13 Aug '20

13 Aug '20

Hi, I'm trying to generate a ribbons diagram where the secondary structures are defined by user and colored by user. I'm running into a problem where half of the amino acid is assigned the secondary structure and the entire residue is assigned the color. This makes for a strange image. Attached is an image. Notice how the coloring starts before the secondary structure. Any help is appreciated.? Best wishes, Reza Reza Khayat, PhD Assistant Professor City College of New York Department of Chemistry and Biochemistry New York, NY 10031

2 4

Limits on movies
by mailman-bounces＠cgl.ucsf.edu 13 Aug '20

13 Aug '20

From: Maria Maldonado <mmaldo(a)ucdavis.edu <mailto:mmaldo@ucdavis.edu>> Subject: Limits on movies Date: August 9, 2020 at 7:23:21 PM PDT Hi! I have a question about movies and thought you might be able to help. Is there a limit to the length of the movies other than the limit maxframes? I’ve made scripts for movies with several steps. All the motions/commands show in the ChimeraX window while it is rendering, the script gets to the end and says “movie encoded”. However, when I open the movie file, the movie is missing several frames/steps. This happens even though I increased the limit maxframes (and my movies should be shorter than 15000 to begin with). If I split the original movie into shorter chunks that works fine, but I’ll have to edit the steps together in a different programme. I was wondering if this has to do with ChimeraX, or whether maybe it could be a computer memory issue or something else outside of the programme? It seems to be worse (ie the movie file stops earlier) for larger volumes and models than for smaller ones. Thank you very much for your help! Best, Maria

4 6

chimerax amino acid sequence
by Peter Steinhagen 09 Aug '20

09 Aug '20

Hello, I am new to chimerax. For my protein of interest, there is no PDB available, thus, I chose a similar protein. However, the amino acid sequence is different. Is it possible to change the amino acid structure in chimerax? Will this change the 3D conformation? If this does not work what would be a good solution for my problem? Thanks, Peter

2 2

Command line utility for .cmap
by Daniel Asarnow 06 Aug '20

06 Aug '20

Hi all, I have only been able to load volume series data using the .cmap format (using a daily from this week on OS X). Is there a command-line utility, perhaps ChimeraX itself, that can generate a .cmap file from a number .mrc volumes? It would be nice to generate these on my processing machine and then only download the .cmaps to my laptop. Best, -da

4 6

Server maintenance
by Eric Pettersen 06 Aug '20

06 Aug '20

Hi all, The servers that usually host the Chimera web site and web services will be undergoing maintenance Monday and Tuesday of next week (August 10/11), but we have jury-rigged a temporary solution that should allow the web site and services to continue to function through the maintenance window. Nonetheless, do not be shocked if the site/services wind up being down on those days. Also, mail to the Chimera mailing lists and Chimera bug reports will be not be fully processed until the servers fully come back up on Wednesday. Such mail/reports will be accepted but spooled during the maintenance window, and delivered afterward. So you probably will not get any responses until Wednesday/Thursday. --Eric Eric Pettersen UCSF Computer Graphics Lab

1 1

ChimeraX Toolshed will be down 10-11 August 2020
by Greg Couch 05 Aug '20

05 Aug '20

Hello everyone, The ChimeraX Toolshed will be down for two days starting Monday, August 10th, 2020. This is due to a major infrastructure upgrade. We are planning to keep the regular ChimeraX web site up during that time, but there's a small chance that it will be down too. Everything should be back to normal by Wednesday, August 13th. If not, we will be frantically working on getting it back up :-). -- Greg

1 1

Fit map in map and save result map
by Luis José Castillo Valverde 05 Aug '20

05 Aug '20

Hello, I know that the ones I am going to ask maybe a recurring question but I have not managed to solve it. I know that maps as such do not have location or rotation information, but I want to generate a new map (with a new cube I imagine) which represents the current position and rotation for a given map. I am working with "fitmap (map # 1) inmap (map # 2)" the idea is to generate the new map from the optimized map, to be able to load that new "result" map without the need to perform any other transformation. If this is possible, I wanted to know if you can give me the command list to be able to do it? I already appreciate the attention provided. Best regards, Luis -- Luis José Castillo Valverde Ingeniero en Computación, TEC Costa Rica Estudiante de maestría (MSc) académica en Computación, TEC Costa Rica Telegram: @LCastillo98 LinkedIn: luisjosecastillo98

2 2

OpenGL error with nogui?
by Fabian Glaser 01 Aug '20

01 Aug '20

Dear gurus, I am trying to produce a series of figures on the fly with chimeraX, using a python script of the following format (this is only a simple demo): test.py: #!/usr/bin/env python3 import sys from chimerax.core.commands import run run(session, "open 1d66") run(session, "color red") run (session, "save fig1.png”) == This works like a charm with the gui, but without the gui it gives the following error, stops and no figure is produced, we tried both in Mac and linux. We are interest in the —nogui option: .../MacOS/ChimeraX --script "test.py 1d66" —nogui Executing: surface sel-residues enclose sel-residues Executing: transparency 0 ribbons Set transparency of 542 residues Executing: ~select Nothing selected Nothing selected Executing: save fig1.jpg Unable to save images because OpenGL rendering is not available So is this solvable? How? We tried also with the —offscreen, no luck either. Best, Fabian Fabian Glaser PhD Bioinformatics Knowledge Unit - BKU The Lorry I. Lokey Center for Life Sciences and Engineering Technion - Israel Institute of Technology, Haifa, Israel Web https://lokey.technion.ac.il/bioinformatic-knowledge-unit/ Tel +972 (0) 4 8293701

2 1

command: symmetry, option: contact
by Roberto Marabini 31 Jul '20

31 Jul '20

Dear all, In chimera I used to use the command sym #0 group i,222r contact 3 to surround an asymmetric unit cell by its neighbors. I see that, in chimerax, "sym" no longer has the option "contact" (or the alternative option "range"). Is there any way to get results similar to the ones obtained using chiera command sym #0 group i,222r contact 3 with chimerax

4 4

Cartoon and ribbon display - change atoms for nucleic acid from C5' to Phosphate
by bertrand beckert 31 Jul '20

31 Jul '20

Dear ChimeraX developper, I was wondering if in ChimeraX it is possible to change the atoms used for the cartoon/ribbon display. According to the online user manual ( https://www.rbvi.ucsf.edu/chimerax/docs/user/commands/cartoon.html#top) for the nucleic acid the cartoon path seems to be restricted and guided by only the C5'.... could it be possible to change the C5' to the Phosphate instead? is there already a command existing ? Thanks for the nice software! Best regards Bertrand

2 1

Re: [chimerax-users] ChimeraX command line iterate through models for individual file export
by Tom Goddard 30 Jul '20

30 Jul '20

Hi Austin, Of course I remember you, it was a great trip to Rocky Mountain Laboratories. Thanks for your hospitality! And I see your SARS-Cov-2 images in the media -- very nice. Here's the ChimeraX voodoo to save all your objs in one command perframe "save ~/Desktop/objs/model$1.obj model #1.$1" frames 23 It uses the perframe command that runs another command once each frame (usually used for recording an animation video). The $1 gets the frame number substituted in 1, 2, 3 and the frames tells it how many frames, in your case use 100 to get the 100 models. Here are the perframe docs https://www.cgl.ucsf.edu/chimerax/docs/user/commands/perframe.html <https://www.cgl.ucsf.edu/chimerax/docs/user/commands/perframe.html> if you need more info. Tom > On Jul 29, 2020, at 10:19 PM, Athman, Austin (NIH/NIAID) [E] <austin.athman(a)nih.gov> wrote: > > Tom, > > I’m Austin Athman, from the NIAID Rocky Mountain Laboratories Visual Arts Department. I took some of your sessions on ChimeraX when you were out to Hamilton MT in the past, and I believe you assisted my colleague Ryan Kissinger on some ChimeraX questions he had. I have one for you I hope you can help. > > I have received a morphing model of the spike protein on RSV for an animation project we are working on for Barney Graham and Jason McLellan. The morph is in 100 steps, and I have 2 different morphs (one for attachment, and another for fusion), making 200 steps total. I am exporting the surface model of each step to an OBJ file for use in our animation software. I have managed to write a single command line that I copy/paste in over and over, changing just the id and file number for export to get the files I need. > > Is there a way I can automate this further, so that ChimeraX will iterate through each id and export to individual files for me without copy/pasting the command each time and modifying it? It would save me hours of time. > > Unfortunately, I am very new to ChimeraX, and know only enough to get me into trouble, specifically, how to show/hide surfaces, and export! > > Here is a screenshot of my model, and also the Excel doc I use to keep track and build my command for each file export, just so you can see what I am doing at the moment. It takes some time for each to save as well, so I don’t know if that delay will make it difficult for the command line to wait and continue each time for each export. There may be some additional commands I can just add between each line in the excel, and I can just copy and past the entire thing and let it run, but that is where I hope you might be able to tell me what I am missing. > > Hope you are well in these times. Also, thank you for your work and videos on coronavirus. Good informative stuff. > > -Austin Athman > > > > <image006.jpg> > > <image008.jpg> > > > > > -- > <image009.png> > ..................................................................... > Rocky Mountain Laboratories NIH/NIAID > Research Technologies Branch <http://myrtb.nih.gov/> > 903 South 4th Street > Hamilton MT 59840 > Phone: (406) 375-7480 > > DISCLAIMER: The information in this e-mail and any of its attachments is confidential and may contain sensitive information. It should not be used by anyone who is not the original intended recipient. If you have received this e-mail in error please inform the sender and delete it from your mailbox or any other storage devices. National Institute of Allergy and Infectious Diseases shall not accept liability for any statements made that are sender's own and not expressly made on behalf of the NIAID by one of its representatives.

1 0

source code of ChimeraX
by Сергій Кущ 29 Jul '20

29 Jul '20

Hello! How to download source code of ChimeraX?

2 1

VOP cover command?
by Megan Mayer 29 Jul '20

29 Jul '20

Hi chimeraX forum, I am trying to get an electron density map (.mrc) to overlap with atomic structure (.cif) file of a small organic molecule. When I open my electron density map in ChimeraX, only one rectangle ( i am assuming one lattice piece) appears, which does not encapsulate the entire small molecule. I am thinking to use the "vop cover" command to get the density to expand to multiple lattices, but I am not sure what numbers to enter. When I try "vop cover atomBox #2" (#2 is the ID of the .cif structure), I get a "Missing or invalid 'volumes' argument: invalid density map specifier" response. Thanks in advance for any help!! Megan

2 6

Can I get atomic coordinates from an electron density map in xplor format via ChimeraX software?
by 王超 28 Jul '20

28 Jul '20

3 2

Interfaces
by Reza Khayat 27 Jul '20

27 Jul '20

?Hi, Is it possible to save the image generated with residue plot from command interfaces? I can use screen capture to do this, but an internal save would keep the images a constant size. Thanks. Best wishes, Reza Reza Khayat, PhD Associate Professor City College of New York Department of Chemistry and Biochemistry New York, NY 10031

2 2

Clip surface but not atoms
by Pufall, Miles A 27 Jul '20

27 Jul '20

Hi! I’ve used Chimera for years (though not recently) and am switching to ChimeraX. I’m looking to display the ligand binding pocket with the ligand, and the tutorial you have is great. I generated this picture, which is really close to what I want. It shows the ligand, and the pocket, and I’m able to slice it with the interactive side view tool to get to this point. However, the left side of the ligand is slightly clipped. I’ve played with rotation and with moving the slice plane, but can’t find an orientation that shows the pocket so nicely (without any surface in the foreground) and not ligand clipping. My question is: is there a way to tell ChimeraX to clip the surface but not the ligand? Thanks! Miles [cid:9F2E9E3C-2209-4033-98F8-C1726F0DFD85@dynamic.uiowa.edu] ________________________________ Notice: This UI Health Care e-mail (including attachments) is covered by the Electronic Communications Privacy Act, 18 U.S.C. 2510-2521 and is intended only for the use of the individual or entity to which it is addressed, and may contain information that is privileged, confidential, and exempt from disclosure under applicable law. If you are not the intended recipient, any dissemination, distribution or copying of this communication is strictly prohibited. If you have received this communication in error, please notify the sender immediately and delete or destroy all copies of the original message and attachments thereto. Email sent to or from UI Health Care may be retained as required by law or regulation. Thank you. ________________________________

3 9

Alternate locations
by Jeschke Gunnar 27 Jul '20

27 Jul '20

Hi ChimeraX team, very nice program and remote control scheme! Clear thinking, cool implementation. My question/suggestion is about alternate atom locations. ChimeraX knows about them. I load 1lcd info atoms /A:8@NE2 attribute alt_locs correctly responds: atom id /A:8@NE2 alt_locs A,B When I show /A:8@NE2 or I show /A:8 as sticks, only location A is displayed. When I retrieve atom coordinates, only location A is returned. Could you implement full handling of alternate locations (or am I doing something wrong here? I really tried a lot to find location B). Kind regards Gunnar --- Der Schlaf der Vernunft gebiert Ungeheuer - Francisco Goya Prof. Dr. Gunnar Jeschke ETH Zurich Department of Chemistry and Applied Biosciences Vladimir-Prelog-Weg 2 CH-8093 Zurich Switzerland www.epr.ethz.ch

2 4

surface colouring by selected residues
by Oleksiy Kovtun 27 Jul '20

27 Jul '20

Dear ChimeraX community, I need to colour the surface by selected side chains to highlight an intermolecular contact. The command sequence: #select atoms on the buried surface. The selection works correctly: measure buriedarea #10/C:449-end withAtoms2 #9/A:449-end select true #make a surface. A new surface #10.1 is generated: surface #10/C resolution 7 #color surface yellow at selected residues. color #10 & sel yellow target s The last command does not result in surface colouring although reports "colored 1 surfaces" upon its execution. Where is a mistake in the colouring approach? I run chimeraX version 1.0 (2020-06-04) on Ubuntu 18.04. Thank you and best regards. Oleksiy Dr Oleksiy Kovtun Research Fellow Briggs group MRC Laboratory of Molecular Biology Francis Crick Avenue Cambridge CB2 0QH UK Tel: + 44 1223 267551 Email: okovtun(a)mrc-lmb.cam.ac.uk

3 4

Cleanest Way to Install Daily Build
by Anderson, Jacob 24 Jul '20

24 Jul '20

Just wanted to reach out to see if there is a clean way to replace one's current ChimeraX with the daily-build (specifically Ubuntu). Is it best to uninstall/the prior and just install the desired version? Thank you for any thoughts! ~jacob

2 1

CryoET map problems
by Andrea Dallapè 21 Jul '20

21 Jul '20

Hi, I have an EM map -from a cryoET experiment- and I would like to use ChimeraX in order to fit the protein -the ribosome, in this case- in such EM map. I don't understand why the PDB of the ribosome I open in ChimeraX is far bigger than the EM map I have, and I don't really know how to resize them in order to have a fittable model. Could you suggest me a solution? Thank you for your help and attention, Andrea

2 1

How to set RGB color for user selected atoms?
by Donovan Chin 17 Jul '20

17 Jul '20

Hi How do i set RGB colors for user-selected atoms? Or for custom atom selections? Cmd line? Regards -D Donovan Chin | Director of Computational Drug Discovery | +1 617 899 5333 | dchin(a)arrakistx.com<mailto:dchin@arrakistx.com> Disclaimer The information contained in this communication from the sender is confidential. It is intended solely for use by the recipient and others authorized to receive it. If you are not the recipient, you are hereby notified that any disclosure, copying, distribution or taking action in relation of the contents of this information is strictly prohibited and may be unlawful. This email has been scanned for viruses and malware.

2 1

Bond between two sequential residues
by Derek Harris 17 Jul '20

17 Jul '20

Hello, When I hide the backbone and choose to show side chain and base any sequential residues shown have a small line between the CA's. I can select them, but not delete them or hide them as an atom or bond, only hide sel, but when the selection they are a part of is hidden and reshown they reappear. I can also assign them as a selector and hide/show them, but also as soon as I hide and reshow the selection they are a part of they reappear and the designated selector for them is gone from the list. I want to retain the side chain and base appearance but lose these lines permanently. Any help would be appreciated. Derek Harris Postdoctoral Fellow Seefeldt Lab Department of Chemistry and Biochemistry Utah State University

3 5

About "color by RMSD "
by Dr.Jason 17 Jul '20

17 Jul '20

Dear Chiemra X team: Briefly, I want to ask you how to color a protein structure by RMSD in chimera X, after done matchmaker of two structures ? I know chimera can do this job, but I did’t find the equivalent function in chimera X. Allen Wu Allenwu1991(a)163.com Chengdu. China

2 2

Re: [chimerax-users] Using Vive controllers with webcam function in ChimeraX
by Tom Goddard 15 Jul '20

15 Jul '20

Hi Józef, The Vive controllers only work in VR mode. You could enable VR mode and just not put on the headset. The "vr roomCamera" command would allow showing the molecular graphics in the desktop window from a specific position which you would want to match your webcam's physical position in the VR space. And you will want to match the vr roomCamera field of view to the field of view of the webcam. Then you will have several problems. First, the hand controller cones won't line up perfectly with the video of the hand controllers -- there will be unpleasant lag. And without the VR headset on it will be very challenging to point at things. But you might as well put on the VR headset to solve that. Then it should work -- you can use the VR with webcam AR. This is just what I did with VR plus a depth sensing camera except that the depth camera also can blend the depth correctly. Tom > On Jul 15, 2020, at 12:22 PM, Lewandowski, Jozef <J.R.Lewandowski(a)warwick.ac.uk <mailto:J.R.Lewandowski@warwick.ac.uk>> wrote: > > Hi Tom, > > Would it be possible to use Vive controllers without going into the vr mode but rather during the webcam session? > > Thanks, > Józef > > ------------------------------------------------------------------------------------------------------ > Józef R. Lewandowski > Professor | Department of Chemistry | University of Warwick <http://www2.warwick.ac.uk/> > j.r.lewandowski(a)warwick.ac.uk <mailto:j.r.lewandowski@warwick.ac.uk> | External: +44 (0) 24 76151355 | Internal: 51355 > Millburn House: F07 | Coventry CV4 7AL | Find us on the interactive map <http://www2.warwick.ac.uk/about/visiting/maps/interactive/> > Lewandowski group website <https://www2.warwick.ac.uk/fac/sci/chemistry/research/lewandowski/lewandows…> | Warwick solid-state NMR group website <http://www2.warwick.ac.uk/fac/sci/physics/research/condensedmatt/nmr/>

1 0

Non existent attributes default to all objects
by Daniel Esteban Palma Igor 15 Jul '20

15 Jul '20

Hi, if in a command you use an attribute that does not exist, ChimeraX (1.0) uses all the objects, for example: show @@asdf Is this intended? Regards, Daniel Palma Igor

2 1

Color electrostatic ValueError
by Maria Maldonado 14 Jul '20

14 Jul '20

Hello ChimeraX team, I was hoping you could help me with a python error I get when trying to use the color electrostatic command. I have my protein surface and my electrostatic map from Delphi in cube format. When I run “color electrostatic #1 map #2 palette -10,red:0,white:10,blue”, I get long error ending in “ValueError: The truth value of an array with more than one element is ambiguous. Use a.any() or a.all() File "/programs/i386-mac/chimerax/0.91/ChimeraX.app/Contents/Library/Frameworks/Python.framework/Versions/3.7/lib/python3.7/site-packages/chimerax/map/data/gaussian/gaussian_format.py", line 120, in matrix if self.matrices == None: See log for complete Python traceback.” (I can send you the full error if useful.) I don’t get the error if I use a Delphi .phi file. However, the .phi files from this Delphi version have a bug that distorts the map, so the Delphi developers recommended using the .cube format instead. (The newer version of Delphi does not seem available for Mac at the moment.) Is the ValueError to do with ChimeraX or is it something to do with the .cube files? Do you have any suggestions as to how to solve this? Thank you very much for all your help, Maria

3 3

Re: [chimerax-users] unsubscribe to ChimeraX-users Digest, Vol 43, Issue 15
by Hua tiger 14 Jul '20

14 Jul '20

On Tue, Jul 14, 2020 at 11:31 AM <chimerax-users-request(a)cgl.ucsf.edu> wrote: > Send ChimeraX-users mailing list submissions to > chimerax-users(a)cgl.ucsf.edu > > To subscribe or unsubscribe via the World Wide Web, visit > https://www.rbvi.ucsf.edu/mailman/listinfo/chimerax-users > or, via email, send a message with subject or body 'help' to > chimerax-users-request(a)cgl.ucsf.edu > > You can reach the person managing the list at > chimerax-users-owner(a)cgl.ucsf.edu > > When replying, please edit your Subject line so it is more specific > than "Re: Contents of ChimeraX-users digest..." > > > Today's Topics: > > 1. Re: re-assignment of mousemode (Elaine Meng) > 2. Re: re-assignment of mousemode (piskacek(a)post.cz) > 3. Re: re-assignment of mousemode (Elaine Meng) > 4. Fwd: [Chimera-users] re-assignment of mousemode (Elaine Meng) > > > ---------------------------------------------------------------------- > > Message: 1 > Date: Mon, 13 Jul 2020 13:45:33 -0700 > From: Elaine Meng <meng(a)cgl.ucsf.edu> > To: "<piskacek(a)post.cz>" <piskacek(a)post.cz> > Cc: ChimeraX Users Help <chimerax-users(a)cgl.ucsf.edu> > Subject: Re: [chimerax-users] re-assignment of mousemode > Message-ID: <3BB2DAA6-5B94-4965-B973-F72CFA5E2CFC(a)cgl.ucsf.edu> > Content-Type: text/plain; charset=us-ascii > > Another way to set pivot (without changing mouse-button functions) is by: > > (1) selecting an atom (Ctrl-click on the atom in the graphics window) that > you want as the center of rotation > (2) using menu: Actions... Set Pivot > > Elaine > > > On Jul 13, 2020, at 1:00 PM, Elaine Meng <meng(a)cgl.ucsf.edu> wrote: > > > > Hi Martin, > > It is not clear what you mean by "no response." Do you have a mouse > with a right button, or can you use trackpad + Alt as the right button? If > you click any other icons in the Right Mouse tab of the Toolbar, can you > successfully assign any of those other functions to the right mouse button? > > > > Maybe it is a misunderstanding of how the icons work: > > If it is working correctly, nothing will happen when you click a RIght > Mouse icon, except that there will be a light green box around that icon. > Clicking the icon only reassigns the function of the right mouse button, > but does not perform any action at that time. However, if you reassign to > pivot by clicking the Right Mouse pivot icon, for example, then later > clicking with the right mouse button (if you have one) on an atom will make > that atom the pivot point. > > > > <http://rbvi.ucsf.edu/chimerax/docs/user/tools/mousemodes.html> > > > > If you do not have a right mouse button, you can use the "mousemode" > command (instead of icons) to assign the function to a different mouse > button. > > <http://rbvi.ucsf.edu/chimerax/docs/user/commands/ui.html#mousemode> > > > > I hope this helps, > > Elaine > > ----- > > Elaine C. Meng, Ph.D. > > UCSF Chimera(X) team > > Department of Pharmaceutical Chemistry > > University of California, San Francisco > > > >> On Jul 13, 2020, at 9:02 AM, <piskacek(a)post.cz> <piskacek(a)post.cz> > wrote: > >> > >> Dear Authors of ChimeraX, > >> > >> I load and start to use your very useful program ChimeraX on Windows 10 > >> (Alienware 17 x64, I7-4900MQ 2.8GHz, RAM 32GB, GeForce GTX 780M), > >> > >> I could do the same and more as in PyMol, but > >> I have trouble with re-assignment of mousemode in window "Right Mouse" > >> as result is no response for re-assignment into Pivot or Rotate model > >> > >> I tried ChimeraX versions 0,93, 1.0 and 1.1 (daily version) w/o > improvement > >> > >> Please, could you help me > >> Thank you very much for support > >> > > > > > > _______________________________________________ > > ChimeraX-users mailing list > > ChimeraX-users(a)cgl.ucsf.edu > > Manage subscription: > > https://www.rbvi.ucsf.edu/mailman/listinfo/chimerax-users > > > > > ------------------------------ > > Message: 2 > Date: Mon, 13 Jul 2020 23:48:44 +0200 (CEST) > From: <piskacek(a)post.cz> > To: "ChimeraX Users Help" <chimerax-users(a)cgl.ucsf.edu> > Subject: Re: [chimerax-users] re-assignment of mousemode > Message-ID: <KC.3Mchj.NQenTdcZLM.1V3DQy(a)seznam.cz> > Content-Type: text/plain; charset="utf-8" > > exactly? all as you described all this is not working > > > > I assigned what my wright? mouse should execute,? > > but if I try to apply this function on amino acid from my protein it is > not > working > > > > Should I need to activate my mousemode somehow? > > I? suppose, that ChimeraX? is not working properly on windows in my case > I need some correction of some script to solve some hidden conflict in > windows > > thank you very much for you help > -- > Martin Piskacek > Laboratory of Cancer Biology and Genetics? > www.piskacek.org > Department of Pathological Physiology > Faculty of Medicine > Masaryk University Brno > Kamenice 5 > 625 00 Brno > Czech Republic > > > ---------- P?vodn? e-mail ---------- > Od: Elaine Meng <meng(a)cgl.ucsf.edu> > Komu: <piskacek(a)post.cz> <piskacek(a)post.cz> > Datum: 13. 7. 2020 22:45:47 > P?edm?t: Re: [chimerax-users] re-assignment of mousemode > "Another way to set pivot (without changing mouse-button functions) is by: > > (1) selecting an atom (Ctrl-click on the atom in the graphics window) that > you want as the center of rotation > (2) using menu: Actions... Set Pivot > > Elaine > > > On Jul 13, 2020, at 1:00 PM, Elaine Meng <meng(a)cgl.ucsf.edu> wrote: > > > > Hi Martin, > > It is not clear what you mean by "no response." Do you have a mouse with > a > right button, or can you use trackpad + Alt as the right button? If you > click any other icons in the Right Mouse tab of the Toolbar, can you > successfully assign any of those other functions to the right mouse > button? > > > > Maybe it is a misunderstanding of how the icons work: > > If it is working correctly, nothing will happen when you click a RIght > Mouse icon, except that there will be a light green box around that icon. > Clicking the icon only reassigns the function of the right mouse button, > but > does not perform any action at that time. However, if you reassign to > pivot > by clicking the Right Mouse pivot icon, for example, then later clicking > with the right mouse button (if you have one) on an atom will make that > atom > the pivot point. > > > > <http://rbvi.ucsf.edu/chimerax/docs/user/tools/mousemodes.html> > > > > If you do not have a right mouse button, you can use the "mousemode" > command (instead of icons) to assign the function to a different mouse > button. > > <http://rbvi.ucsf.edu/chimerax/docs/user/commands/ui.html#mousemode> > > > > I hope this helps, > > Elaine > > ----- > > Elaine C. Meng, Ph.D. > > UCSF Chimera(X) team > > Department of Pharmaceutical Chemistry > > University of California, San Francisco > > > >> On Jul 13, 2020, at 9:02 AM, <piskacek(a)post.cz> <piskacek(a)post.cz> > wrote: > > >> > >> Dear Authors of ChimeraX, > >> > >> I load and start to use your very useful program ChimeraX on Windows 10 > >> (Alienware 17 x64, I7-4900MQ 2.8GHz, RAM 32GB, GeForce GTX 780M), > >> > >> I could do the same and more as in PyMol, but > >> I have trouble with re-assignment of mousemode in window "Right Mouse" > >> as result is no response for re-assignment into Pivot or Rotate model > >> > >> I tried ChimeraX versions 0,93, 1.0 and 1.1 (daily version) w/o > improvement > >> > >> Please, could you help me > >> Thank you very much for support > >> > > > > > > _______________________________________________ > > ChimeraX-users mailing list > > ChimeraX-users(a)cgl.ucsf.edu > > Manage subscription: > > https://www.rbvi.ucsf.edu/mailman/listinfo/chimerax-users > > " >

1 0

Fwd: [Chimera-users] re-assignment of mousemode
by Elaine Meng 14 Jul '20

14 Jul '20

sending to chimerax-users instead of chimera-users (I'd accidentally set the "reply-to" to the wrong list, sorry -- Elaine ) > Begin forwarded message: > > From: Elaine Meng <meng(a)cgl.ucsf.edu> > Subject: Re: [Chimera-users] [chimerax-users] re-assignment of mousemode > Date: July 14, 2020 at 8:25:20 AM PDT > To: "<piskacek(a)post.cz>" <piskacek(a)post.cz> > Cc: "chimera-users(a)cgl.ucsf.edu BB" <chimera-users(a)cgl.ucsf.edu> > Reply-To: "chimera-users(a)cgl.ucsf.edu BB" <chimera-users(a)cgl.ucsf.edu> > > Hi Martin, > The "Pivot" function sets the center of rotation for the whole view, for when you rotate everything with the mouse. It does not rotate the bond. If you want to rotate the bond, instead use the "Bond rotation" mouse mode, the icon much further right on the same toolbar as shown in your image. > > The Right Mouse icons and what they mean are listed here: > <http://rbvi.ucsf.edu/chimerax/docs/user/tools/mousemodes.html> > > Best, > Elaine > ----- > Elaine C. Meng, Ph.D. > UCSF Chimera(X) team > Department of Pharmaceutical Chemistry > University of California, San Francisco > > >> On Jul 14, 2020, at 5:16 AM, <piskacek(a)post.cz> <piskacek(a)post.cz> wrote: >> >> Dear Elaine, >> thank you very much for your assistance, but >> I do everything correctly, but it just did not work = see figure >> I would like to rotate tryptofan in my figure, so as first I need to set pivot on the C-atom (designated here as CB) and than rotate with right mouse the tryptofan >> >> <Mail Attachment.png> > > > _______________________________________________ > Chimera-users mailing list: Chimera-users(a)cgl.ucsf.edu > Manage subscription: https://www.rbvi.ucsf.edu/mailman/listinfo/chimera-users

1 0

re-assignment of mousemode
by piskacek＠post.cz 13 Jul '20

13 Jul '20

Dear Authors of ChimeraX, I load and start to use your very useful program ChimeraX on Windows 10 (Alienware 17 x64, I7-4900MQ 2.8GHz, RAM 32GB, GeForce GTX 780M), I could do the same and more as in PyMol, but I have trouble with re-assignment of mousemode in window "Right Mouse" as result is no response for re-assignment into Pivot or Rotate model I tried ChimeraX versions 0,93, 1.0 and 1.1 (daily version) w/o improvement Please, could you help me Thank you very much for support -- Martin Piskacek Laboratory of Cancer Biology and Genetics www.piskacek.org Department of Pathological Physiology Faculty of Medicine Masaryk University Brno Kamenice 5 625 00 Brno Czech Republic

2 4

ChimeraZ: show surface under another surface
by Anastasiya Oguienko 13 Jul '20

13 Jul '20

Dear ChimeraX developers, Hello! Thanks for this amazing tool, I enjoy every second of using it! I have a question about surface imaging: I have several subunits in the protein, and I would like to show surfaces of particular regions of different subunits. However, when one surface is above another, the lower one is not displayed no matter what the transparency value is. Is there a way to display both of the overlapping surfaces? Thanks in advance! -- With Best Regards, Anastasiya Oguienko

3 2

Which color/palette was used
by Maria Maldonado 10 Jul '20

10 Jul '20

Hello, I was wondering if there’s a command that reports the color/palette of a chain/model. I saved a session with the palette I wanted, but didn’t make a note of what the palette was, and I would now like to use the same palette on a different session. Thank you for your help! Maria

2 1

[chimeraX-users] to display cylinder and helical ribbon of one chain
by Yingyi Zhang 10 Jul '20

10 Jul '20

Dear ChimeraX Team, I have one model (pdb format), which contains multiple chains. Each chain (chain A for instance) consists of several helices. Is it possible to display ChainA in this manner - first two helices as cylinders but the others as ribbons? I tried to specify the residues, but it always changed the entire presence of the model, including the un-selected ones. Could you help me with this? I am still not very familiar with chimeraX. Thank you very much. Best regards, Yingyi

2 3

Subscript in 2Dlabels
by Derek Harris 08 Jul '20

08 Jul '20

Is there a way, or code, to do sub/superscripts in a 2Dlabel? Derek Harris Postdoctoral Fellow Seefeldt Lab Department of Chemistry and Biochemistry Utah State University

2 1

Re: [chimerax-users] label_seq_id in mmcif files for Chimera
by Greg Couch 08 Jul '20

08 Jul '20

On 7/7/2020 3:50 PM, Marcin Wojdyr wrote: > On Tue, 7 Jul 2020 at 22:38, Greg Couch <gregc(a)cgl.ucsf.edu> wrote: >> As you know, the entity_poly_seq table says which polymeric residues are >> adjacent to each other (entity_poly_seq.num values are the >> atom_site.label_seq_id values). > Yes, it's an enhanced equivalent of the SEQRES record in the PDB > format. Files from the wwPDB always have it, but files from other > sources will often miss it. I think currently almost all the mmCIF > files in circulation originate from the wwPDB. But this is slowly > changing and people are starting to use mmCIF as a working format. The sequence information is extremely useful for eliminating ambiguities in the atom_site data. And it is frequently known by the user, even when it is missing from the mmCIF file. >> Without that information, ChimeraX >> still needs the atom_site.label_seq_id to imply the polymeric ordering. > Ok. It would be useful, though, if ChimeraX could infer the ordering > and connectivity in the same way as it does for PDB files. > > Thanks, > Marcin Adding a atom_site.label_seq_id isn't different from supplying a residue number in PDB file. When there are adjacent residues of the same type, does the PDB reader see a duplicate atom and generate a new residue? merge the residues? generate an error? I haven't tested the PDB reader, but a residue number helps it too. Learning to use mmCIF effectively will take time. Programmers should use the PDB's mmCIF Dictionary Suite to validate the mmCIF their programs output -- it won't validate completely (because it's for mmCIF files served by the PDB), but it will show where the mmCIF output can be improved. For more information about ChimeraX reading mmCIF, see https://www.rbvi.ucsf.edu/chimerax/docs/devel/bundles/mmcif/src/mmcif_guide…. ChimeraX's mmCIF reader tries really hard to show you the data exactly as it is specified. So if there's badly specified data, you'll be able to see it. Over time, we will improve ChimeraX's ability to handle underspecified data as developers start generating mmCIF files. But we don't plan to modify the mmCIF reader if we can help it. Adding code, to infer information that should be explicitly given in the mmCIF file, slows down the mmCIF reader for everyone. This is especially true for large structures with over a million atoms. -- Greg

3 4

Re: [chimerax-users] [Chimera-users] Chimera X - Windows 7 home premium
by Greg Couch 08 Jul '20

08 Jul '20

(This is a ChimeraX question, so sending the reply to the chimerax-users mailing too.) Looking at the image, the three gray boxes are icons for previously opened data files. To get an interactive 3D image, you would need to open an appropriate data file. If you type in the command "open 3rec" and press Enter/Return afterwards to open PDB model 3rec, does an interactive 3D image show up? If you can't get an interactive 3D image, then you probably need a newer graphics driver. I'd recommend going to the Lenovo support web site and installing a newer graphics driver. If the driver from Lenovo doesn't fix the problem, then you'll need to get one directly from Intel at https://downloadcenter.intel.com/. From the DxDiag.txt output, you have a 2nd generation i7 with HD Graphics 3000 driver version 8.15.10.2656. Lenovo has version 8.15.10.2274 from 6/9/2011 for your computer. On the Intel site, I see that version 15.28.24.4229 from 6/5/2015 is available. And you should know that we don't test ChimeraX on Windows 7, so technically you are on an unsupported platform. That said, we are unaware of anything that would prevent ChimeraX from running on Windows 7. However, with the age of your laptop, you should consider switching from Windows to Ubuntu (Linux). Intel is still supporting the Linux graphics driver for older systems. HTH, Greg On 7/8/2020 7:29 AM, MONICA MESA CADAVID wrote: > I would like to use the new Chimera X. > I installed and open the program easily. > But the images did not appear. > I attach the information of my computer because I would like to know > if I can fix the problem. > Thank you > * > * > image.png > *Monica Mesa Cadavid* > Profesor Titular > Instituto de Quimica > Facultad de Ciencias Exactas y Naturales > monica.mesa(a)udea.edu.co <http://udea.edu.co/> > Grupo Ciencia de los Materiales > Sede de Investigacion Universitaria, SIU -Torre 1, laboratorio 310 > Cra 53 # 61 - 30 > Tel. 574 - 219 6546 > > http://www.udea.edu.co/ <http://www.udea.edu.co/> > > > > *Universidad de Antioquia* > www.udea.edu.co <http://www.udea.edu.co/> > Sede Principal: Cll 67 # 53 - 108 > Medellín, Colombia > > "La información aquí contenida es para uso exclusivo de la persona o > entidad de destino. Está estrictamente prohibida su utilización, > copia, descarga, distribución, modificación y/o reproducción total o > parcial, sin el permiso expreso de Universidad de Antioquia, pues su > contenido puede ser de carácter confidencial y/o contener material > privilegiado. Si usted recibió esta información por error, por favor > contacte en forma inmediata a quien la envió y borre este material de > su computador. Universidad de Antioquia no es responsable por la > información contenida en esta comunicación, el directo responsable es > quien la firma o el autor de la misma." > > > > "La información aquí contenida es para uso exclusivo de la persona o > entidad de destino. Está estrictamente prohibida su utilización, > copia, descarga, distribución, modificación y/o reproducción total o > parcial, sin el permiso expreso de Universidad de Antioquia, pues su > contenido puede ser de carácter confidencial y/o contener material > privilegiado. Si usted recibió esta información por error, por favor > contacte en forma inmediata a quien la envió y borre este material de > su computador. Universidad de Antioquia no es responsable por la > información contenida en esta comunicación, el directo responsable es > quien la firma o el autor de la misma." > > _______________________________________________ > Chimera-users mailing list: Chimera-users(a)cgl.ucsf.edu > Manage subscription: https://www.rbvi.ucsf.edu/mailman/listinfo/chimera-users

1 0

ChimeraX bug report submission
by Nicco 08 Jul '20

08 Jul '20

The following bug report has been submitted: Platform: Darwin-19.3.0-x86_64-i386-64bit ChimeraX Version: 1.0 (2020-06-04 23:15:07 UTC) Description Hi, I'm trying to record a movie and the movie generated stops before executing all final steps. It's like the last frames are not recorded even when I see a very high limit. I feel like movie encode starts processing before it is called. For example these commands below are not present in the movie but the movie encode is called afterwards. # Select last interaction area select /F:370,375 /E:270,309,314 show sel atoms hbonds sel select clear # Final show turn x 15 60 rock 130 turn -y 15 60 rock 130 I'm a bit puzzled of why this is happening and I don't really now how to fix it. I attach the .cxc file with the set of instructions that I use to create the movie. Please consider that my experience level is beginner so there could be something that I'm doing wrong. Thank you! Nicco Log: UCSF ChimeraX version: 1.0 (2020-06-04) © 2016-2020 Regents of the University of California. All rights reserved. How to cite UCSF ChimeraX > open "/Users/niar/Dropbox (CRG > ADV)/Nicco/projects/06_Chimera/src/movies/6NQ3_Suz12_AS_event.cxc" > open 6NQ3 6nq3 title: Crystal Structure of a SUZ12-RBBP4-PHF19-JARID2 Heterotetrameric Complex [more info...] Chain information for 6nq3 #1 --- Chain | Description A E | Histone-binding protein RBBP4 B F | Polycomb protein SUZ12 C G | PHD finger protein 19 D H | Protein Jumonji Non-standard residues in 6nq3 #1 --- ZN — zinc ion 6nq3 mmCIF Assemblies --- 1| software_defined_assembly 2| software_defined_assembly > select all 11928 atoms, 12213 bonds, 30 pseudobonds, 3 models selected > show sel cartoons > style sel stick Changed 11928 atom styles > hide sel atoms > select /A,B,C,G,D,H 6565 atoms, 6720 bonds, 15 pseudobonds, 3 models selected > hide sel cartoons > select /E 3045 atoms, 3128 bonds, 2 pseudobonds, 2 models selected > color (#!1 & sel) purple > select /F 2318 atoms, 2365 bonds, 13 pseudobonds, 3 models selected > color (#!1 & sel) cyan > select clear > set bgColor white > lighting soft > graphics silhouettes true > view > view name start > movie record supersample 1 size 720,720 limit 5000 directory > /Users/niar/Desktop/tmp_chimera pattern Frame_n* > turn z -70 > turn x 24 > turn y -40 > view name hole > wait 5 > select sequence > EEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLP 1138 atoms, 1174 bonds, 1 model selected > color sel orange > select clear > wait 10 > select sequence NHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYT 540 atoms, 552 bonds, 1 model selected > color sel spring green > select clear > wait 10 > select sequence GHQKEGYGLSWNPNLSGHLLSASDDHTICLWD 500 atoms, 516 bonds, 1 model selected > color sel spring green > select clear > wait 10 > select sequence GHTAVVEDVSWHLLHESLFGSVADDQKLMIWD 512 atoms, 526 bonds, 1 model selected > color sel spring green > select clear > wait 10 > select sequence AHTAEVNCLSFNPYSEFILATGSADKTVALWD 488 atoms, 500 bonds, 1 model selected > color sel spring green > select clear > wait 10 > select sequence SHKDEIFQVQWSPHNETILASSGTDRRLNVWD 532 atoms, 546 bonds, 1 model selected > color sel spring green > select clear > wait 10 > select sequence GHTAKISDFSWNPNEPWVICSVSEDNIMQVWQ 522 atoms, 540 bonds, 1 model selected > color sel spring green > select clear > wait 10 > select sequence RKTFKVDDMLSKVEKMKGEQESH 299 atoms, 299 bonds, 1 model selected > color sel red > select clear > wait 10 > turn x 20 120 rock 120 > wait > turn y 35 150 rock 150 > wait > turn y 4 90 > wait > turn y 1 50 > wait > turn x 1 35 > wait > zoom 1.5 80 > wait > move x 0.75 15 > move y -0.75 15 > wait > view name side > select /E:9-28 /E:32-39 239 atoms, 242 bonds, 1 model selected > show sel atoms > hbonds sel 51 hydrogen bonds found > select clear > wait 20 > turn x 15 60 rock 60 > wait > turn y 15 60 rock 60 > wait > ~hbonds > select /E:9-28 /E:32-39 239 atoms, 242 bonds, 1 model selected > hide sel atoms > select clear > wait 5 > move y 0.75 15 > move x -0.75 15 > wait > zoom 0.5 80 > wait > turn -x 1 35 > wait > turn -y 1 50 > wait > view hole > move x 0.75 25 > move y -0.5 25 > wait 25 > turn x 0.5 25 > zoom 3 80 > wait 80 > turn x 0.75 25 > move y 0.5 25 > wait 25 > view name zoom1 > select /F:129 /E:409 /E:346 31 atoms, 29 bonds, 1 model selected > show sel atoms > color (#!1 & sel) byelement > hbonds sel 12 hydrogen bonds found > select clear > wait 15 > turn -y 15 120 rock 120 > wait > turn x 15 60 rock 130 > wait > wait 15 > view name zoom2 > turn y -1.5 25 > move x -0.5 25 > wait 25 > turn x -1 25 > turn z 1 25 > move x 0.4 25 > wait 25 > select /F:135 /E:285,304,330 34 atoms, 30 bonds, 1 model selected > show sel atoms > color (#!1 & sel) byelement > hbonds sel 11 hydrogen bonds found > select clear > turn y -10 120 rock 180 > wait > turn x 15 120 rock 120 > wait > wait 20 > view name zoom3 > zoom 0.5 50 > turn -y 1 150 > wait > move x 0.75 15 > wait > turn x 1 20 > wait > zoom 1.5 50 > select /F:370,375 /E:270,309,314 42 atoms, 37 bonds, 1 model selected > show sel atoms > hbonds sel 8 hydrogen bonds found > select clear > turn x 15 60 rock 130 > turn -y 15 60 rock 130 > movie status \-----Movie status------------------------------ Recording 1785 frames (in 'PPM' format) saved to directory '/Users/niar/Desktop/tmp_chimera' using pattern 'Frame_n*' . Est. movie length is 74.375s. \------------------------------------------------ > movie encode /Users/niar/Desktop/Suz12_test1.mp4 format h264 quality low > wait true verbose false Movie saved to /Users/niar/Desktop/Suz12_test1.mp4 executed 6NQ3_Suz12_AS_event.cxc OpenGL version: 4.1 INTEL-14.4.23 OpenGL renderer: Intel(R) Iris(TM) Graphics 6100 OpenGL vendor: Intel Inc.Hardware: Hardware Overview: Model Name: MacBook Pro Model Identifier: MacBookPro12,1 Processor Name: Dual-Core Intel Core i5 Processor Speed: 2,7 GHz Number of Processors: 1 Total Number of Cores: 2 L2 Cache (per Core): 256 KB L3 Cache: 3 MB Hyper-Threading Technology: Enabled Memory: 8 GB Boot ROM Version: 189.0.0.0.0 SMC Version (system): 2.28f7 Software: System Software Overview: System Version: macOS 10.15.3 (19D76) Kernel Version: Darwin 19.3.0 Time since boot: 1 day 20:31 Graphics/Displays: Intel Iris Graphics 6100: Chipset Model: Intel Iris Graphics 6100 Type: GPU Bus: Built-In VRAM (Dynamic, Max): 1536 MB Vendor: Intel Device ID: 0x162b Revision ID: 0x0009 Metal: Supported, feature set macOS GPUFamily1 v4 Displays: Color LCD: Display Type: Built-In Retina LCD Resolution: 2560 x 1600 Retina Framebuffer Depth: 24-Bit Color (ARGB8888) Main Display: Yes Mirror: Off Online: Yes Automatically Adjust Brightness: No Connection Type: Internal HP LP2065: Resolution: 1600 x 1200 (UXGA - Ultra eXtended Graphics Array) UI Looks like: 1600 x 1200 @ 60 Hz Framebuffer Depth: 24-Bit Color (ARGB8888) Display Serial Number: CNG70302V3 Mirror: Off Online: Yes Rotation: Supported Automatically Adjust Brightness: No PyQt version: 5.12.3 Compiled Qt version: 5.12.4 Runtime Qt version: 5.12.8 File attachment: 6NQ3_Suz12_AS_event.cxc

3 3

Re: [chimerax-users] [Chimera-users] Difference in alignment of cofactor between Chimera and ChimeraX
by Elaine Meng 07 Jul '20

07 Jul '20

Hello Derek, You're welcome! Thought I should also mention that in matchmaker you can specify more than one pair of chains, i.e. use multiple pairs of chains for the fit. Which way is better depends on what you are trying to achieve: overall superposition of whole complex, or best fit of a single pair of chains. This multichain fit can be done in either Chimera or ChimeraX with a matchmaker command option. I'll use ChimeraX commands to illustrate: open 3u7q open 5n6y hide ribbon The ChimeraX log shows that 3u7q has four chains, two alpha (A,C) and two beta (B,D) whereas 5n6y has 6 chains, two alpha (A,D), two beta (B,E) and two delta (C,F). So perhaps you want to use all of the alpha and beta chains from the structures for the fit instead of only A with A. Now the trick is to figure out which alpha goes with which alpha and which beta with which beta. I might be lazy and first just try ABCD in 3u7q as pairing with ABDE in 5n6y and see if that looks right. I might also use coloring by polymer (figures out a color based on chain sequence) to make it clearer what's what. color bypolymer mm #2/A,B,D,E to #1/A,B,C,D pair ss <http://rbvi.ucsf.edu/chimerax/docs/user/commands/matchmaker.html> .... which actually looks right. The alphas and betas are colored the same within a given PDB structure but different between the structures, probably because of small sequence differences (something like one structure has a couple more residues on one end or the other; I didn't investigate, but it's expected). The Log reports: RMSD between 1026 pruned atom pairs is 1.314 angstroms; (across all 1783 pairs: 3.281) ...now to check the placement of cofactors: show ligand ~ribbon You can see a more symmetrical fit, with similar displacements on both sides. I hope this helps, Elaine > On Jul 7, 2020, at 9:39 AM, Derek Harris <derek.harris(a)aggiemail.usu.edu> wrote: > > Hello Elaine, > > Thank you very much for the rapid response. Following your commands, and seeing all the ligands, I now see what's happening. Just as you said; the proteins are each composed of two identical catalytic halves. In one half there is a nice alignment of the cofactors, but in the other half there is not. I was isolating, and only viewing, the chain where there isn't good alignment. > > Thanks again! > > Derek Harris > Postdoctoral Fellow > Seefeldt Lab > Department of Chemistry and Biochemistry > Utah State University > > > On Tue, Jul 7, 2020 at 9:35 AM Elaine Meng <meng(a)cgl.ucsf.edu> wrote: > Hello Derek, > It does not make sense for the cofactor alignment to be different if the protein alignment is the same, because the cofactors are just moved rigidly along with their proteins. Also the results should be identical between Chimera and ChimeraX, assuming you are using the same options. > > I get exactly the same alignment between these two proteins in the Chimera vs. ChimeraX. > > Chimera commands (including display ligand only): > open 3u7q > open 5n6y > mm #0 #1 > ~ribbon > show ligand > > ChimeraX commands: > open 3u7q > open 5n6y > mm #2 to #1 > ~ribbon > hide > show ligand > > In both programs, I get the same RMSD message to the Log: > > RMSD between 375 pruned atom pairs is 0.968 angstroms; (across all 450 pairs: 2.998) > > In both programs, matchmaker ends up choosing to align chain A to chain A. Thus the cofactors in chains A are better superimposed than the ones in the other chains. > > I hope this helps, > Elaine > ----- > Elaine C. Meng, Ph.D. > UCSF Chimera(X) team > Department of Pharmaceutical Chemistry > University of California, San Francisco > > > On Jul 6, 2020, at 6:47 PM, Derek Harris <derek.harris(a)aggiemail.usu.edu> wrote: > > > > Hello, > > > > I am trying to reproduce an alignment I had previously done in Chimera in ChimeraX with matchmaker command. > > > > The protein alignment between the two programs is the same, but in ChimeraX the active-site cofactor of the matchstruct isn't aligning appropriately to the refstruct cofactor and is unreasonably placed in relation to even its own protein. In Chimera the two cofactors align nicely. > > > > The two structures I am trying to align are 3U7Q and 5N6Y. > > > > Thanks in advance for any assistance you can offer! > > > > Derek Harris > > Postdoctoral Fellow > > Seefeldt Lab > > Department of Chemistry and Biochemistry > > Utah State University > > _______________________________________________ > Chimera-users mailing list: Chimera-users(a)cgl.ucsf.edu > Manage subscription: https://www.rbvi.ucsf.edu/mailman/listinfo/chimera-users

2 1

how to turn molecule centering a specific atom in ChimeraX
by Shin Inchul 07 Jul '20

07 Jul '20

Hi, I was trying to turn molecule around specific atom. Since I am a beginner of ChimeraX, I would like to have some working examples in the command line. Without it, I have difficulties in applying the usage as appeared in the user guide. In PyMOL, mouse middle button click on a atom sets the centering on the atom then use rotate command. I appreciate all the supports provided. Thank you. Inchul

3 3

Re: [chimerax-users] session file sizes
by Tom Goddard 07 Jul '20

07 Jul '20

To close molecular surfaces surface close #1 or just surf close If instead you do ~surface that hides the surface. I discourage use of these obscure "~" commands that Chimera used. Use "surface hide #1" or "surface close #1". If you just hide the surfaces they are still in the session file. You can also see the surface models in Model Panel by clicking the little triangle and the left of the model name to show submodel of your molecule. And you can choose those surface models and close them. Tom > On Jul 7, 2020, at 2:48 PM, Melissa Jurica <mjurica(a)ucsc.edu> wrote: > > That was my first guess, so I turned off the surface view. However, no change in file size. I don’t see how to delete the surface that I calculated- still trying to get the hang of ChimeraX after switching from Chimera. > > > ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ > Melissa S. Jurica, Ph.D. > Professor, Molecular, Cell & Developmental Biology > Center for Molecular Biology of RNA > University of California, Santa Cruz > 1156 High Street > Santa Cruz, CA 95064 > > Office: 450 Sinsheimer Labs Lab: 434 Sinsheimer Labs > Office phone (831) 459-4427 Lab phone (831) 459-2463 Fax (831) 459-3139 > http://www.mcd.ucsc.edu/faculty/jurica.html <http://www.mcd.ucsc.edu/faculty/jurica.html> > ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ > >> On Jul 7, 2020, at 2:41 PM, Tom Goddard <goddard(a)sonic.net <mailto:goddard@sonic.net>> wrote: >> >> Hi Melissa, >> >> Molecular surfaces make session files very large because they save all the surface triangles. Did you have a molecular surface in that large session? I have considered not saving the molecular surfaces and just recomputing them although that will make restoring the session slower as it tries to recompute the surface. >> >> Tom >> >> >>> On Jul 7, 2020, at 2:28 PM, Melissa Jurica <mjurica(a)ucsc.edu <mailto:mjurica@ucsc.edu>> wrote: >>> >>> What deterimines the file size of saved ChimeraX sessions (.csx files)? I saved a session of one structure (6Y5q) at 4 MB, and another structure (6y50) at 2.6 MB. However, when I saved a session with both structures open, it was a whopping 120.6 MB. Is there a way to reduce that file size? >>> >>> ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ >>> Melissa S. Jurica, Ph.D. >>> Professor, Molecular, Cell & Developmental Biology >>> Center for Molecular Biology of RNA >>> University of California, Santa Cruz >>> 1156 High Street >>> Santa Cruz, CA 95064 >>> >>> Office: 450 Sinsheimer Labs Lab: 434 Sinsheimer Labs >>> Office phone (831) 459-4427 Lab phone (831) 459-2463 Fax (831) 459-3139 >>> http://www.mcd.ucsc.edu/faculty/jurica.html <http://www.mcd.ucsc.edu/faculty/jurica.html> >>> ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ >>> >>> _______________________________________________ >>> ChimeraX-users mailing list >>> ChimeraX-users(a)cgl.ucsf.edu <mailto:ChimeraX-users@cgl.ucsf.edu> >>> Manage subscription: >>> https://www.rbvi.ucsf.edu/mailman/listinfo/chimerax-users <https://www.rbvi.ucsf.edu/mailman/listinfo/chimerax-users> >> >

1 0

session file sizes
by Melissa Jurica 07 Jul '20

07 Jul '20

What deterimines the file size of saved ChimeraX sessions (.csx files)? I saved a session of one structure (6Y5q) at 4 MB, and another structure (6y50) at 2.6 MB. However, when I saved a session with both structures open, it was a whopping 120.6 MB. Is there a way to reduce that file size? ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ Melissa S. Jurica, Ph.D. Professor, Molecular, Cell & Developmental Biology Center for Molecular Biology of RNA University of California, Santa Cruz 1156 High Street Santa Cruz, CA 95064 Office: 450 Sinsheimer Labs Lab: 434 Sinsheimer Labs Office phone (831) 459-4427 Lab phone (831) 459-2463 Fax (831) 459-3139 http://www.mcd.ucsc.edu/faculty/jurica.html <http://www.mcd.ucsc.edu/faculty/jurica.html> ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^

2 1

label_seq_id in mmcif files for Chimera
by Marcin Wojdyr 07 Jul '20

07 Jul '20

Hi, I'd like to generate mmCIF files (using my own software) that can be read by Chimera. The problem is that sometimes I don't know the full sequence (SEQRES), so I don't know values for _atom_site.label_seq_id. If I skip label_seq_id entirely, the file doesn't load. ChimeraX gives warning: "Skipping atom_site category: Missing column 'label_seq_id'". If I set all label_seq_id values to null ('.') I get warning: "Unable to infer polymer connectivity due to unspecified label_seq_id for residue "ARG" near line 125" and all residues are disconnected. How should the mmCIF look like so that Chimera infers the connectivity in the same way as it does for PDB files? Cheers, Marcin

2 1

Re: [chimerax-users] [ChimeraX] #3464: partial surface mesh
by Elaine Meng 07 Jul '20

07 Jul '20

Hi Rory, There is no "hydrophobic surface" ... maybe you mean the molecular surface shown as solid (not dot or mesh)? Chimera's presets include "hydrophobicity surface" which is perhaps misleading, simply means the molecular surface colored by hydrophobicity. What exactly are you trying to do? Show protein as mesh surface and ligand as solid surface? You can definitely do it (or any combination of mesh surface on some atoms, solid on some other atoms) by opening multiple copies of the structure, as we said in previous messages. Then in the solid-surface copy, only show the parts of the surface you want as solid. In the mesh-surface copy, show the parts you want as mesh. For example, here is an example that shows H-ras as mesh surface with its ligand GCP as solid surface (image attached below), commands: open 121p open 121p surf #1 & protein surf #2:gcp surf style #1 mesh transp #1 50 surfaces color #2 gold surfaces hide solvent This can all be done with the menu as well, but it would take a lot more typing to enter that whole procedure. I Cc'd chimerax-users(a)cgl.ucsf.edu which is the recommended address for asking ChimeraX questions (for future reference). I hope this helps, Elaine ----- Elaine C. Meng, Ph.D. UCSF Chimera(X) team Department of Pharmaceutical Chemistry University of California, San Francisco > On Jul 6, 2020, at 10:30 AM, Gordon, Rory <rory.gordon.19(a)ucl.ac.uk> wrote: > > Hi Guys, > > Further to previous email, just tried fiddling with the transparency settings. > > I can get the protein structure to change through the transparency gradient for hydrophobic surface. > > However, for the substrate/ligands there seems to be binary system where you can either have full transparency or none at all. > > The hydrophobic surface can be coloured both for the protein and substrate/ligand. > > Cheers, > > Rory > From: Gordon, Rory <rory.gordon.19(a)ucl.ac.uk> > Sent: 06 July 2020 18:26 > To: Tom Goddard <goddard(a)sonic.net>; Elaine Meng <meng(a)cgl.ucsf.edu> > Cc: Eric Pettersen <pett(a)cgl.ucsf.edu> > Subject: Re: [ChimeraX] #3464: partial surface mesh > > Hi Tom, Elaine and Eric > > I tried to establish the mesh surface with the whole protein structure selected through the GUI. I can only get the hydrophobic surface which I can colour with B-factor. > > The options of Mesh, Dot or Solid don't seem to change anything. > > Not sure how to get round this, so any help would be appreciated. > > Cheers, > > Rory > > > From: Tom Goddard <goddard(a)sonic.net> > Sent: 02 July 2020 18:24 > To: Elaine Meng <meng(a)cgl.ucsf.edu> > Cc: Gordon, Rory <rory.gordon.19(a)ucl.ac.uk>; Eric Pettersen <pett(a)cgl.ucsf.edu> > Subject: Re: [ChimeraX] #3464: partial surface mesh > > Another trick that makes these meshes look nicer is to make them about 50-80% transparent (command "transp #2 70"). It gives the mesh an airy look. > > Tom > > >> On Jul 2, 2020, at 10:17 AM, Elaine Meng <meng(a)cgl.ucsf.edu> wrote: >> >> Hi Rory, >> Here is an example image where I opened the same structure twice. I showed one copy with mesh surface and the second one with solid surface, and then simply hid parts of the solid surface. This is the way that Tom mentioned. >> Elaine >> >> <example.png> >> >> >>> On Jul 2, 2020, at 3:29 AM, ChimeraX <ChimeraX-bugs-admin(a)cgl.ucsf.edu> wrote: >>> >>> #3464: partial surface mesh >>> ---------------------------------------+---------------------------- >>> Reporter: rory.gordon.19@… | Owner: Eric Pettersen >>> Type: defect | Status: closed >>> Priority: normal | Milestone: >>> Component: Surface | Version: >>> Resolution: fixed | Keywords: >>> Blocked By: | Blocking: >>> Notify when closed: | Platform: all >>> Project: ChimeraX | >>> ---------------------------------------+---------------------------- >>> >>> Comment (by rory.gordon.19@…): >>> >>> {{{ >>> Hi Eric, >>> >>> Thanks for your email. >>> >>> I had actually seen a graphic in a publication which gave me that idea. >>> >>> Thanks anyway for the pointers. >>> >>> Cheers, >>> >>> Rory >>> ________________________________ >>> From: ChimeraX <ChimeraX-bugs-admin(a)cgl.ucsf.edu> >>> Sent: 01 July 2020 18:23 >>> Cc: goddard(a)cgl.ucsf.edu <goddard(a)cgl.ucsf.edu>; meng(a)cgl.ucsf.edu >>> <meng(a)cgl.ucsf.edu>; pett(a)cgl.ucsf.edu <pett(a)cgl.ucsf.edu>; Gordon, Rory >>> <rory.gordon.19(a)ucl.ac.uk> >>> Subject: Re: [ChimeraX] #3464: partial surface mesh (was: ChimeraX bug >>> report submission) >>> >>> #3464: partial surface mesh >>> ---------------------------------------+---------------------------- >>> Reporter: rory.gordon.19@… | Owner: Eric Pettersen >>> Type: defect | Status: accepted >>> Priority: normal | Milestone: >>> Component: Unassigned | Version: >>> Resolution: | Keywords: >>> Blocked By: | Blocking: >>> Notify when closed: | Platform: all >>> Project: ChimeraX | >>> ---------------------------------------+---------------------------- >>> Changes (by Eric Pettersen): >>> >>> * status: new => accepted >>> * cc: Tom Goddard, Elaine Meng (added) >>> * project: => ChimeraX >>> * platform: => all >>> * owner: (none) => Eric Pettersen >>> >>> >>> Comment: >>> >>> Hi Rory, >>> I don't believe you can change just part of a surface into mesh, >>> it's all or nothing. You can make that part of the surface partially >>> transparent instead with Actions→Surface→Transparency. >>> >>> --Eric >>> >>> Eric Pettersen >>> UCSF Computer Graphics Lab >>> >>> ----- >>> Tom, should the command "surface style (#!4 & sel) mesh" actually do >>> nothing (with part of the surface selected)? That seems surprising. >>> Seems like it should change the whole surface into mesh. Is that a bug >>> or >>> am I misunderstanding something? >>> >>> --Eric >>> >>> -- >>> Ticket URL: >>> <https://eur01.safelinks.protection.outlook.com/?url=https%3A%2F%2Fplato.cgl…> >>> ChimeraX >>> <https://eur01.safelinks.protection.outlook.com/?url=http%3A%2F%2Fwww.rbvi.u…> >>> ChimeraX Issue Tracker >>> }}} >>> >>> -- >>> Ticket URL: <https://plato.cgl.ucsf.edu/trac/ChimeraX/ticket/3464#comment:7> >>> ChimeraX <http://www.rbvi.ucsf.edu/chimerax/> >>> ChimeraX Issue Tracker

2 1

artificial lines or seems on surface using soft lighting
by Steve Chou 06 Jul '20

06 Jul '20

Hi ChimeraX folks, When I used soft lighting, I saw lines/seams on the molecular surface (see the attached image). To reproduce this: ---------------------- load xxxx.pdb surface color violet lighting soft ---------------------- How to remove these artificial lines/seams? These lines also show up in the cutting plane in a section view. Many thanks in advance! Steve -- Steve Chou

2 2

Can I only clip some models, but not all of them?
by Steve Chou 05 Jul '20

05 Jul '20

Hi ChimeraX developers and users, When a ligand is embedded in the protein, can I only clip the surface of the protein, but not the ligand (sticks)? Many thanks, Steve -- Steve Chou

2 1

How to obtain size measures
by Andrea Dallapè 04 Jul '20

04 Jul '20

Dear UCSF Chimera and ChimeraX developers, I would like to ask you if there's a method to obtain the size measures of a protein in order to compare with the heights and lengths obtained by AFM. Could you please suggest me how could I obtain such measurements? Thank you in advance for your help and support, Andrea

2 2

color offset and surface type for mapping Electrostatic Potential
by Steve Chou 02 Jul '20

02 Jul '20

Hello everyone, I tried to map Electrostatic Potential (ESP) onto the molecular surface in ChimeraX v1.0 and PyMOL v2.1, but I found that the results were very different in these two programs. Therefore, I wrote to Elaine Meng and Tom Goddard for help. For your reference, I repost the ideals of our emails below. I first calculated the ESP with DelPhi v5.1 (a relatively old version) to get the .phi file (ESP). PyMOL commands for displaying ESP on the molecular surface are as follows: ------------------------------------------------ load 1ubq.pdb bg_color white remove resn hoh remove hydrogens hide line select heavy, name c*+o*+s*+n* show surface load 1ubq.phi, e_map ramp_new e_lvl, e_map, [-7, 0, 7] set surface_color, e_lvl, 1ubq set light_count, 1 set ambient, 0.5 set reflect, 0.2 ------------------------------------------------ ChimeraX commands for displaying ESP on the molecular surface are as follows: ------------------------------------------------ open 1ubq.pdb open 1ubq.phi hide #2 set bg white surface #1 color electrostatic #1 map #2 palette -7,red:0,white:7,blue material dull lighting simple ------------------------------------------------ In PyMOL, the colors (red/blue) are mainly on the residue (E/D, K/R) tips, while in ChimeraX, the colors are spread. Besides, the surface shapes are also slightly different in these two programs. See the image (left and middle panels) for the different colors and shapes. The color difference is caused by the color offset. The shape difference is also explained below. I changed the color offset to 0. Now the color looks similar in these two programs (left and right panels). The color offset (1.4 A) in ChimeraX gives a better idea of the possible charge interactions with other molecules. ------------------------------------------------ color electrostatic #1 map #2 palette -7,red:0,white:7,blue offset 0.0 ------------------------------------------------ The summary of the explanations from Tom: ------------------------------------------------ One idea I have for why PyMol shows redder tips is because ChimeraX is showing the potential 1.4 Angstroms away from the surface since that is about how far away a binding molecule would be. PyMol may be showing the ESP values exactly on the surface. You can try using 0 offset instead of 1.4 with the "color electrostatic" command "offset" parameter. https://www.cgl.ucsf.edu/chimerax/docs/user/commands/color.html#map ------------------------------------------------ The summary of the explanations from Elaine: ------------------------------------------------ As Tom mentioned, the rationale for the 1.4 A projection is that Chimera and ChimeraX show the solvent-excluded surface (SES), as opposed to the solvent-accessible surface (SAS). The SAS is approximately half a probe radius outward, and the SAS represents the closest possible approach of atomic centers of waters or ligands interacting with the protein, so the result is coloring by what values of the electrostatic potential (ESP) that such ligands would "see". The diagram in this page shows the relationships among SES, SAS, and probe. <http://rbvi.ucsf.edu/chimerax/docs/user/commands/surface.html> Possible reasons for difference in Pymol, if the ESP map itself is identical: (1) coloring by offset values or not. It has been my general understanding that when programs color the SES by ESP, the default approach is to color by the values one surface-probe radius outward. (2) shape/location of the surface. Is it an SES or SAS, or neither? Pymol surfaces often look more "melty" or smoothed to me than the SES in Chimera/ChimeraX. (3) the exact color-mapping, i.e. which colors at which values. Pymol ESP coloring often uses a duller-looking blue. ------------------------------------------------ All the best, Steve -- Steve Chou

1 0

color key
by Roberto Marabini 02 Jul '20

02 Jul '20

hi, Is there a colorkey command in chimeraX (http://www.rbvi.ucsf.edu/chimera/docs/ContributedSoftware/2dlabels/2dlabels…>)? If it does not exist, is there any alternative other than using chimera and photoshop? Thanks Roberto

3 3

Is color command slower in ChimeraX than Chimera?
by Mungo Carstairs (Staff) 30 Jun '20

30 Jun '20

Hi, I'm testing driving ChimeraX (or Chimera) from Jalview, in particular colouring structures using the Jalview alignment residue colouring. Ideally this should perform well at scale for large numbers of structures and/or colours (for example a graduated colouring based on some property). I've noticed that ChimeraX appears to do this slower than Chimera. Is there a reason, or something I should do to make the command faster? Here's an example like for like comparison using the Chimera/X command line (also attached as a text file): Chimera 1.15 (build 42156) > open cifID:4zho cifID:5h92 cifID:1a70 cifID:4zhp > focus > color #977b64 #0:2.A,2.B;color #e46daf #0:3.A,3.B;color #7dc891 #0:4.A,4.B;color #768daf #0:5.A,5.B;color #bb1691 #0:6.A,6.B;color #1c5355 #0:7.A,7.B;color #5b1873 #0:8.A,8.B;color #d0af91 #0:9.A,9.B;color #6cb737 #0:10.A,10.B;color #8d7c55 #0:11.A,11.B;color #844173 #0:12.A,12.B;color #1f15a0 #0:13.A,13.B;color #a27f91 #0:14.A,14.B;color #19cb64 #0:15.A,15.B;color #484537 #0:16.A,16.B;color #61be37 #0:17.A,17.B;color #84a173 #0:18.A,18.B;color #c76691 #0:19.A,19.B;color #8f31a0 #0:20.A,20.B;color #9eb9af #0:21.A,21.B;color #531564 #0:22.A,22.B;color #707046 #0:23.A,23.B;color #9b80af #0:24.A,24.B;color #ca18a0 #0:25.A,25.B;color #377382 #0:26.A,26.B;color #26a137 #0:27.A,27.B;color #d3b1a0 #0:28.A,28.B;color #e267af #0:29.A,29.B;color #c023af #0:30.A,30.B;color #b18da0 #0:31.A,31.B;color #88bb55 #0:32.A,32.B;color #1fada0 #0:33.A,33.B;color #b22773 #0:34.A,34.B;color #ad19be #0:35.A,35.B;color #6483af #0:36.A,36.B;color #c9de91 #0:37.A,37.B;color #aab2be #0:38.A,38.B;color #59d164 #0:39.A,39.B;color #6d6037 #0:40.A,40.B;color #1cd937 #0:41.A,41.B;color #b5cb82 #0:42.A,42.B;color #e28191 #0:43.A,43.B;color #9537a0 #0:44.A,44.B;color #d6b0a0 #0:45.A,45.B;color #3bcf46 #0:46.A,46.B;color #2c6737 #0:47.A,47.B;color #e586af #0:48.A,48.B;color #e22daf #0:49.A,49.B;color #e29d91 #0:50.A,50.B;color #493582 #0:51.A,51.B;color #cacca0 #0:52.A,52.B;color #7f2855 #0:53.A,53.B;color #86dd91 #0:54.A,54.B;color #b55764 #0:55.A,55.B;color #4ac155 #0:56.A,56.B;color #614a37 #0:57.A,57.B;color #9e69af #0:58.A,58.B;color #5f8855 #0:59.A,59.B;color #958fa0 #0:60.A,60.B;color #9e45af #0:61.A,61.B;color #b9beaf #0:62.A,62.B;color #4add55 #0:63.A,63.B;color #5ba273 #0:64.A,64.B;color #bedf37 #0:65.A,65.B;color #359546 #0:66.A,66.B;color #262d37 #0:67.A,67.B;color #cf5bbe #0:68.A,68.B;color #505c46 #0:69.A,69.B;color #76db37 #0:70.A,70.B;color #3d37be #0:71.A,71.B;color #a28391 #0:72.A,72.B;color #b5cf64 #0:73.A,73.B;color #88b2a0 #0:74.A,74.B;color #bb4a91 #0:75.A,75.B;color #dc8755 #0:76.A,76.B;color #d579a0 #0:77.A,77.B;color #7c9846 #0:78.A,78.B;color #b57b82 #0:79.A,79.B;color #79cd46 #0:80.A,80.B;color #aa1abe #0:81.A,81.B;color #ab4873 #0:82.A,82.B;color #c6df91 #0:83.A,83.B;color #b3b3be #0:84.A,84.B;color #802d91 #0:85.A,85.B;color #d9c4af #0:86.A,86.B;color #c64d91 #0:87.A,87.B;color #857b46 #0:88.A,88.B;color #a26d91 #0:89.A,89.B;color #c62991 #0:90.A,90.B;color #adb1a0 #0:91.A,91.B;color #584991 #0:92.A,92.B;color #93b382 #0:93.A,93.B;color #48e137 #0:94.A,94.B;color #88c56f #1:1.C;color #7b5d60 #1:2.C;color #32d660 #1:3.C;color #339b7e #1:4.C;color #702460 #1:5.C;color #6725ba #1:6.C;color #dc536f #1:7.C;color #a3db7e #1:8.C;color #a8918d #1:9.C;color #d84eba #1:10.C;color #758b7e #1:11.C;color #88d751 #1:12.C;color #75ab7e #1:13.C;color #8e527e #1:14.C;color #cf53d8 #1:15.C;color #dc636f #1:16.C;color #7d288d #1:17.C;color #707460 #1:18.C;color #6fde51 #1:19.C;color #35a960 #1:20.C;color #627d8d #1:21.C;color #bb42ab #1:22.C;color #327060 #1:23.C;color #a3357e #1:24.C;color #28bd8d #1:25.C;color #8f91ba #1:26.C;color #c856d8 #1:27.C;color #795760 #1:28.C;color #c067c9 #1:29.C;color #669b6f #1:30.C;color #adabd8 #1:31.C;color #889d51 #1:32.C;color #c18f9c #1:33.C;color #26bd51 #1:34.C;color #55cdba #1:35.C;color #7e1a60 #1:36.C;color #238451 #1:37.C;color #68678d #1:38.C;color #6da451 #1:39.C;color #a315d8 #1:40.C;color #88256f #1:41.C;color #1f17ba #1:42.C;color #4a456f #1:43.C;color #6da051 #1:44.C;color #a4bfc9 #1:45.C;color #9557ba #1:46.C;color #d6d0ba #1:47.C;color #791d60 #1:48.C;color #e2e1ab #1:49.C;color #1c616f #1:50.C;color #7fda6f #1:51.C;color #8e907e #1:52.C;color #77559c #1:53.C;color #c4bf8d #1:54.C;color #77759c #1:55.C;color #1658d8 #1:56.C;color #add1d8 #1:57.C;color #aa5aba #1:58.C;color #95d3ba #1:59.C;color #adadd8 #1:60.C;color #aa36ba #1:61.C;color #95afba #1:62.C;color #aa74d8 #1:63.C;color #731bd8 #1:64.C;color #442b6f #1:65.C;color #8f1dba #1:66.C;color #882d51 #1:67.C;color #9b2eab #1:68.C;color #764d51 #1:69.C;color #6adb51 #1:70.C;color #359160 #1:71.C;color #e283ab #1:72.C;color #ddb160 #1:73.C;color #cab2ba #1:74.C;color #5559ba #1:75.C;color #8a876f #1:76.C;color #c76aab #1:77.C;color #62a76f #1:78.C;color #793f60 #1:79.C;color #23be51 #1:80.C;color #bab09c #1:81.C;color #99397e #1:82.C;color #a42bc9 #1:83.C;color #53597e #1:84.C;color #165ad8 #1:85.C;color #9d888d #1:86.C;color #d04dab #1:87.C;color #b1d5ba #1:88.C;color #c66dab #1:89.C;color #44a151 #1:90.C;color #df5760 #1:91.C;color #66df6f #1:92.C;color #cf1dd8 #1:93.C;color #a269ab #1:94.C;color #551fba #1:95.C;color #e4a7c9 #1:96.C;color #1f5c8b #2:1.A;color #a68a40 #2:2.A;color #5f3140 #2:3.A;color #76147c #2:4.A;color #9d5140 #2:5.A;color #6c8ed6 #2:6.A;color #37804f #2:7.A;color #8edb31 #2:8.A;color #7b64e5 #2:9.A;color #ab2140 #2:10.A;color #a89a40 #2:11.A;color #b53231 #2:12.A;color #7e247c #2:13.A;color #6125d6 #2:14.A;color #a2265e #2:15.A;color #97bd7c #2:16.A;color #aa556d #2:17.A;color #a9a140 #2:18.A;color #9c3931 #2:19.A;color #9e407c #2:20.A;color #8faa6d #2:21.A;color #166f8b #2:22.A;color #9bd97c #2:23.A;color #76dad6 #2:24.A;color #cd90e5 #2:25.A;color #2628d6 #2:26.A;color #97ce31 #2:27.A;color #e2c07c #2:28.A;color #933a4f #2:29.A;color #cf328b #2:30.A;color #a27e5e #2:31.A;color #b5ca31 #2:32.A;color #946222 #2:33.A;color #8f546d #2:34.A;color #28a040 #2:35.A;color #ab4740 #2:36.A;color #8c1b6d #2:37.A;color #95946d #2:38.A;color #d63b6d #2:39.A;color #76ba5e #2:40.A;color #b5524f #2:41.A;color #8880d6 #2:42.A;color #b3ae8b #2:43.A;color #9acd31 #2:44.A;color #77924f #2:45.A;color #2cc0d6 #2:46.A;color #a9a340 #2:47.A;color #e2867c #2:48.A;color #b5b431 #2:49.A;color #498e4f #2:50.A;color #64627c #2:51.A;color #85188b #2:52.A;color #e4827c #2:53.A;color #1f1a6d #2:54.A;color #a4a27c #2:55.A;color #cdb2e5 #2:56.A;color #60a45e #2:57.A;color #7d2d40 #2:58.A;color #80c45e #2:59.A;color #444422 #2:60.A;color #7ddb40 #2:61.A;color #688240 #2:62.A;color #1fbfd6 #2:63.A;color #46c05e #2:64.A;color #71584f #2:65.A;color #2686d6 #2:66.A;color #353ce5 #2:67.A;color #c85b8b #2:68.A;color #a37a31 #2:69.A;color #3518e5 #2:70.A;color #4882d6 #2:71.A;color #b55631 #2:72.A;color #74487c #2:73.A;color #6149d6 #2:74.A;color #282c40 #2:75.A;color #211e8b #2:76.A;color #22978b #2:77.A;color #7998e5 #2:78.A;color #a66c40 #2:79.A;color #501931 #2:80.A;color #15dd7c #2:81.A;color #ca756d #2:82.A;color #3b94e5 #2:83.A;color #262cd6 #2:84.A;color #7fc322 #2:85.A;color #a88840 #2:86.A;color #2b7a8b #2:87.A;color #486cd6 #2:88.A;color #994031 #2:89.A;color #71ce31 #2:90.A;color #3a8440 #2:91.A;color #ffffff #2:92.A;color #a2c25e #2:93.A;color #cf968b #2:94.A;color #28c440 #2:95.A;color #7b3ee5 #2:96.A;color #6aa8d6 #2:97.A;color #977b82 #3:2.A;color #683191 #3:3.A;color #7dc8af #3:4.A;color #768dcd #3:5.A;color #bb16af #3:6.A;color #1c5373 #3:7.A;color #3727a0 #3:8.A;color #d0afaf #3:9.A;color #6cb755 #3:10.A;color #8d7c73 #3:11.A;color #26d755 #3:12.A;color #1f15be #3:13.A;color #7e3464 #3:14.A;color #df35be #3:15.A;color #484555 #3:16.A;color #9764cd #3:17.A;color #84a191 #3:18.A;color #c766af #3:19.A;color #6f9a55 #3:20.A;color #9eb9cd #3:21.A;color #531582 #3:22.A;color #707064 #3:23.A;color #9b80cd #3:24.A;color #d0dbaf #3:25.A;color #3773a0 #3:26.A;color #26a155 #3:27.A;color #414855 #3:28.A;color #e267cd #3:29.A;color #c023cd #3:30.A;color #b18dbe #3:31.A;color #84d991 #3:32.A;color #1fadbe #3:33.A;color #bc63cd #3:34.A;color #ad19dc #3:35.A;color #6483cd #3:36.A;color #c9deaf #3:37.A;color #aab2dc #3:38.A;color #59d182 #3:39.A;color #6d6055 #3:40.A;color #1cd955 #3:41.A;color #b5cba0 #3:42.A;color #e281af #3:43.A;color #9537be #3:44.A;color #d6b0be #3:45.A;color #3bcf64 #3:46.A;color #2c6755 #3:47.A;color #e586cd #3:48.A;color #e22dcd #3:49.A;color #e29daf #3:50.A;color #4935a0 #3:51.A;color #caccbe #3:52.A;color #d573be #3:53.A;color #e229cd #3:54.A;color #b55782 #3:55.A;color #e449cd #3:56.A;color #614a55 #3:57.A;color #9e69cd #3:58.A;color #5f8873 #3:59.A;color #958fbe #3:60.A;color #9e45cd #3:61.A;color #975564 #3:62.A;color #1cdd73 #3:63.A;color #5ba291 #3:64.A;color #bedf55 #3:65.A;color #359564 #3:66.A;color #262d55 #3:67.A;color #711fa0 #3:68.A;color #505c64 #3:69.A;color #662773 #3:70.A;color #d319be #3:71.A;color #e2a1cd #3:72.A;color #b5cf82 #3:73.A;color #88b2be #3:74.A;color #bb4aaf #3:75.A;color #dc8773 #3:76.A;color #d579be #3:77.A;color #7c9864 #3:78.A;color #9d6c91 #3:79.A;color #79cd64 #3:80.A;color #aa1adc #3:81.A;color #ab4891 #3:82.A;color #1ca373 #3:83.A;color #8b4a73 #3:84.A;color #802daf #3:85.A;color #d9c4cd #3:86.A;color #c64daf #3:87.A;color #857b64 #3:88.A;color #a26daf #3:89.A;color #c629af #3:90.A;color #adb1be #3:91.A;color #5849af #3:92.A;color #93b3a0 #3:93.A;color #48e155 #3:94.A;color #93d3a0 #3:95.A;color #dc4d73 #3:96.A;color #d53fbe #3:97.A;color #6a4f55 #3:98.A On my Macbook these color commands take about 2 seconds. ChimeraX 1.0 (2020-06-04): > open pdb:4zho pdb:5h92 pdb:1a70 pdb:4zhp > view > color #1/A:2/B:2 #977b64;color #1/A:3/B:3 #e46daf;color #1/A:4/B:4 #7dc891;color #1/A:5/B:5 #768daf;color #1/A:6/B:6 #bb1691;color #1/A:7/B:7 #1c5355;color #1/A:8/B:8 #5b1873;color #1/A:9/B:9 #d0af91;color #1/A:10/B:10 #6cb737;color #1/A:11/B:11 #8d7c55;color #1/A:12/B:12 #844173;color #1/A:13/B:13 #1f15a0;color #1/A:14/B:14 #a27f91;color #1/A:15/B:15 #19cb64;color #1/A:16/B:16 #484537;color #1/A:17/B:17 #61be37;color #1/A:18/B:18 #84a173;color #1/A:19/B:19 #c76691;color #1/A:20/B:20 #8f31a0;color #1/A:21/B:21 #9eb9af;color #1/A:22/B:22 #531564;color #1/A:23/B:23 #707046;color #1/A:24/B:24 #9b80af;color #1/A:25/B:25 #ca18a0;color #1/A:26/B:26 #377382;color #1/A:27/B:27 #26a137;color #1/A:28/B:28 #d3b1a0;color #1/A:29/B:29 #e267af;color #1/A:30/B:30 #c023af;color #1/A:31/B:31 #b18da0;color #1/A:32/B:32 #88bb55;color #1/A:33/B:33 #1fada0;color #1/A:34/B:34 #b22773;color #1/A:35/B:35 #ad19be;color #1/A:36/B:36 #6483af;color #1/A:37/B:37 #c9de91;color #1/A:38/B:38 #aab2be;color #1/A:39/B:39 #59d164;color #1/A:40/B:40 #6d6037;color #1/A:41/B:41 #1cd937;color #1/A:42/B:42 #b5cb82;color #1/A:43/B:43 #e28191;color #1/A:44/B:44 #9537a0;color #1/A:45/B:45 #d6b0a0;color #1/A:46/B:46 #3bcf46;color #1/A:47/B:47 #2c6737;color #1/A:48/B:48 #e586af;color #1/A:49/B:49 #e22daf;color #1/A:50/B:50 #e29d91;color #1/A:51/B:51 #493582;color #1/A:52/B:52 #cacca0;color #1/A:53/B:53 #7f2855;color #1/A:54/B:54 #86dd91;color #1/A:55/B:55 #b55764;color #1/A:56/B:56 #4ac155;color #1/A:57/B:57 #614a37;color #1/A:58/B:58 #9e69af;color #1/A:59/B:59 #5f8855;color #1/A:60/B:60 #958fa0;color #1/A:61/B:61 #9e45af;color #1/A:62/B:62 #b9beaf;color #1/A:63/B:63 #4add55;color #1/A:64/B:64 #5ba273;color #1/A:65/B:65 #bedf37;color #1/A:66/B:66 #359546;color #1/A:67/B:67 #262d37;color #1/A:68/B:68 #cf5bbe;color #1/A:69/B:69 #505c46;color #1/A:70/B:70 #76db37;color #1/A:71/B:71 #3d37be;color #1/A:72/B:72 #a28391;color #1/A:73/B:73 #b5cf64;color #1/A:74/B:74 #88b2a0;color #1/A:75/B:75 #bb4a91;color #1/A:76/B:76 #dc8755;color #1/A:77/B:77 #d579a0;color #1/A:78/B:78 #7c9846;color #1/A:79/B:79 #b57b82;color #1/A:80/B:80 #79cd46;color #1/A:81/B:81 #aa1abe;color #1/A:82/B:82 #ab4873;color #1/A:83/B:83 #c6df91;color #1/A:84/B:84 #b3b3be;color #1/A:85/B:85 #802d91;color #1/A:86/B:86 #d9c4af;color #1/A:87/B:87 #c64d91;color #1/A:88/B:88 #857b46;color #1/A:89/B:89 #a26d91;color #1/A:90/B:90 #c62991;color #1/A:91/B:91 #adb1a0;color #1/A:92/B:92 #584991;color #1/A:93/B:93 #93b382;color #1/A:94/B:94 #48e137;color #2/C:1 #88c56f;color #2/C:2 #7b5d60;color #2/C:3 #32d660;color #2/C:4 #339b7e;color #2/C:5 #702460;color #2/C:6 #6725ba;color #2/C:7 #dc536f;color #2/C:8 #a3db7e;color #2/C:9 #a8918d;color #2/C:10 #d84eba;color #2/C:11 #758b7e;color #2/C:12 #88d751;color #2/C:13 #75ab7e;color #2/C:14 #8e527e;color #2/C:15 #cf53d8;color #2/C:16 #dc636f;color #2/C:17 #7d288d;color #2/C:18 #707460;color #2/C:19 #6fde51;color #2/C:20 #35a960;color #2/C:21 #627d8d;color #2/C:22 #bb42ab;color #2/C:23 #327060;color #2/C:24 #a3357e;color #2/C:25 #28bd8d;color #2/C:26 #8f91ba;color #2/C:27 #c856d8;color #2/C:28 #795760;color #2/C:29 #c067c9;color #2/C:30 #669b6f;color #2/C:31 #adabd8;color #2/C:32 #889d51;color #2/C:33 #c18f9c;color #2/C:34 #26bd51;color #2/C:35 #55cdba;color #2/C:36 #7e1a60;color #2/C:37 #238451;color #2/C:38 #68678d;color #2/C:39 #6da451;color #2/C:40 #a315d8;color #2/C:41 #88256f;color #2/C:42 #1f17ba;color #2/C:43 #4a456f;color #2/C:44 #6da051;color #2/C:45 #a4bfc9;color #2/C:46 #9557ba;color #2/C:47 #d6d0ba;color #2/C:48 #791d60;color #2/C:49 #e2e1ab;color #2/C:50 #1c616f;color #2/C:51 #7fda6f;color #2/C:52 #8e907e;color #2/C:53 #77559c;color #2/C:54 #c4bf8d;color #2/C:55 #77759c;color #2/C:56 #1658d8;color #2/C:57 #add1d8;color #2/C:58 #aa5aba;color #2/C:59 #95d3ba;color #2/C:60 #adadd8;color #2/C:61 #aa36ba;color #2/C:62 #95afba;color #2/C:63 #aa74d8;color #2/C:64 #731bd8;color #2/C:65 #442b6f;color #2/C:66 #8f1dba;color #2/C:67 #882d51;color #2/C:68 #9b2eab;color #2/C:69 #764d51;color #2/C:70 #6adb51;color #2/C:71 #359160;color #2/C:72 #e283ab;color #2/C:73 #ddb160;color #2/C:74 #cab2ba;color #2/C:75 #5559ba;color #2/C:76 #8a876f;color #2/C:77 #c76aab;color #2/C:78 #62a76f;color #2/C:79 #793f60;color #2/C:80 #23be51;color #2/C:81 #bab09c;color #2/C:82 #99397e;color #2/C:83 #a42bc9;color #2/C:84 #53597e;color #2/C:85 #165ad8;color #2/C:86 #9d888d;color #2/C:87 #d04dab;color #2/C:88 #b1d5ba;color #2/C:89 #c66dab;color #2/C:90 #44a151;color #2/C:91 #df5760;color #2/C:92 #66df6f;color #2/C:93 #cf1dd8;color #2/C:94 #a269ab;color #2/C:95 #551fba;color #2/C:96 #e4a7c9;color #3/A:1 #1f5c8b;color #3/A:2 #a68a40;color #3/A:3 #5f3140;color #3/A:4 #76147c;color #3/A:5 #9d5140;color #3/A:6 #6c8ed6;color #3/A:7 #37804f;color #3/A:8 #8edb31;color #3/A:9 #7b64e5;color #3/A:10 #ab2140;color #3/A:11 #a89a40;color #3/A:12 #b53231;color #3/A:13 #7e247c;color #3/A:14 #6125d6;color #3/A:15 #a2265e;color #3/A:16 #97bd7c;color #3/A:17 #aa556d;color #3/A:18 #a9a140;color #3/A:19 #9c3931;color #3/A:20 #9e407c;color #3/A:21 #8faa6d;color #3/A:22 #166f8b;color #3/A:23 #9bd97c;color #3/A:24 #76dad6;color #3/A:25 #cd90e5;color #3/A:26 #2628d6;color #3/A:27 #97ce31;color #3/A:28 #e2c07c;color #3/A:29 #933a4f;color #3/A:30 #cf328b;color #3/A:31 #a27e5e;color #3/A:32 #b5ca31;color #3/A:33 #946222;color #3/A:34 #8f546d;color #3/A:35 #28a040;color #3/A:36 #ab4740;color #3/A:37 #8c1b6d;color #3/A:38 #95946d;color #3/A:39 #d63b6d;color #3/A:40 #76ba5e;color #3/A:41 #b5524f;color #3/A:42 #8880d6;color #3/A:43 #b3ae8b;color #3/A:44 #9acd31;color #3/A:45 #77924f;color #3/A:46 #2cc0d6;color #3/A:47 #a9a340;color #3/A:48 #e2867c;color #3/A:49 #b5b431;color #3/A:50 #498e4f;color #3/A:51 #64627c;color #3/A:52 #85188b;color #3/A:53 #e4827c;color #3/A:54 #1f1a6d;color #3/A:55 #a4a27c;color #3/A:56 #cdb2e5;color #3/A:57 #60a45e;color #3/A:58 #7d2d40;color #3/A:59 #80c45e;color #3/A:60 #444422;color #3/A:61 #7ddb40;color #3/A:62 #688240;color #3/A:63 #1fbfd6;color #3/A:64 #46c05e;color #3/A:65 #71584f;color #3/A:66 #2686d6;color #3/A:67 #353ce5;color #3/A:68 #c85b8b;color #3/A:69 #a37a31;color #3/A:70 #3518e5;color #3/A:71 #4882d6;color #3/A:72 #b55631;color #3/A:73 #74487c;color #3/A:74 #6149d6;color #3/A:75 #282c40;color #3/A:76 #211e8b;color #3/A:77 #22978b;color #3/A:78 #7998e5;color #3/A:79 #a66c40;color #3/A:80 #501931;color #3/A:81 #15dd7c;color #3/A:82 #ca756d;color #3/A:83 #3b94e5;color #3/A:84 #262cd6;color #3/A:85 #7fc322;color #3/A:86 #a88840;color #3/A:87 #2b7a8b;color #3/A:88 #486cd6;color #3/A:89 #994031;color #3/A:90 #71ce31;color #3/A:91 #3a8440;color #3/A:92 #ffffff;color #3/A:93 #a2c25e;color #3/A:94 #cf968b;color #3/A:95 #28c440;color #3/A:96 #7b3ee5;color #3/A:97 #6aa8d6;color #4/A:2 #977b82;color #4/A:3 #683191;color #4/A:4 #7dc8af;color #4/A:5 #768dcd;color #4/A:6 #bb16af;color #4/A:7 #1c5373;color #4/A:8 #3727a0;color #4/A:9 #d0afaf;color #4/A:10 #6cb755;color #4/A:11 #8d7c73;color #4/A:12 #26d755;color #4/A:13 #1f15be;color #4/A:14 #7e3464;color #4/A:15 #df35be;color #4/A:16 #484555;color #4/A:17 #9764cd;color #4/A:18 #84a191;color #4/A:19 #c766af;color #4/A:20 #6f9a55;color #4/A:21 #9eb9cd;color #4/A:22 #531582;color #4/A:23 #707064;color #4/A:24 #9b80cd;color #4/A:25 #d0dbaf;color #4/A:26 #3773a0;color #4/A:27 #26a155;color #4/A:28 #414855;color #4/A:29 #e267cd;color #4/A:30 #c023cd;color #4/A:31 #b18dbe;color #4/A:32 #84d991;color #4/A:33 #1fadbe;color #4/A:34 #bc63cd;color #4/A:35 #ad19dc;color #4/A:36 #6483cd;color #4/A:37 #c9deaf;color #4/A:38 #aab2dc;color #4/A:39 #59d182;color #4/A:40 #6d6055;color #4/A:41 #1cd955;color #4/A:42 #b5cba0;color #4/A:43 #e281af;color #4/A:44 #9537be;color #4/A:45 #d6b0be;color #4/A:46 #3bcf64;color #4/A:47 #2c6755;color #4/A:48 #e586cd;color #4/A:49 #e22dcd;color #4/A:50 #e29daf;color #4/A:51 #4935a0;color #4/A:52 #caccbe;color #4/A:53 #d573be;color #4/A:54 #e229cd;color #4/A:55 #b55782;color #4/A:56 #e449cd;color #4/A:57 #614a55;color #4/A:58 #9e69cd;color #4/A:59 #5f8873;color #4/A:60 #958fbe;color #4/A:61 #9e45cd;color #4/A:62 #975564;color #4/A:63 #1cdd73;color #4/A:64 #5ba291;color #4/A:65 #bedf55;color #4/A:66 #359564;color #4/A:67 #262d55;color #4/A:68 #711fa0;color #4/A:69 #505c64;color #4/A:70 #662773;color #4/A:71 #d319be;color #4/A:72 #e2a1cd;color #4/A:73 #b5cf82;color #4/A:74 #88b2be;color #4/A:75 #bb4aaf;color #4/A:76 #dc8773;color #4/A:77 #d579be;color #4/A:78 #7c9864;color #4/A:79 #9d6c91;color #4/A:80 #79cd64;color #4/A:81 #aa1adc;color #4/A:82 #ab4891;color #4/A:83 #1ca373;color #4/A:84 #8b4a73;color #4/A:85 #802daf;color #4/A:86 #d9c4cd;color #4/A:87 #c64daf;color #4/A:88 #857b64;color #4/A:89 #a26daf;color #4/A:90 #c629af;color #4/A:91 #adb1be;color #4/A:92 #5849af;color #4/A:93 #93b3a0;color #4/A:94 #48e155;color #4/A:95 #93d3a0;color #4/A:96 #dc4d73;color #4/A:97 #d53fbe;color #4/A:98 #6a4f55 These color commands take 15-16 seconds. Thanks, Mungo [University of Dundee shield logo]<http://uod.ac.uk/sig-home> Mungo Carstairs Jalview Computational Scientist The Barton Group Division of Computational Biology School of Life Sciences University of Dundee, Dundee, Scotland, UK www.jalview.org<http://www.jalview.org> www.compbio.dundee.ac.uk<http://www.compbio.dundee.ac.uk> g.m.carstairs(a)dundee.ac.uk<mailto:g.m.carstairs@dundee.ac.uk> [University of Dundee Facebook]<http://uod.ac.uk/sig-fb> [University of Dundee Twitter] <http://uod.ac.uk/sig-tw> [University of Dundee LinkedIn] <http://uod.ac.uk/sig-li> [University of Dundee YouTube] <http://uod.ac.uk/sig-yt> [University of Dundee Instagram] <http://uod.ac.uk/sig-ig> [University of Dundee Snapchat] <http://uod.ac.uk/sig-sc> We're Scottish University of the Year again!<http://uod.ac.uk/sig-strapline> The Times / Sunday Times Good University Guide 2016 and 2017 The University of Dundee is a registered Scottish Charity, No: SC015096

2 1

creating an annotated structure
by Melissa Jurica 30 Jun '20

30 Jun '20

Can you provide some guidelines for how one could create an annotated structure to share with colleagues? For example, I would like to annotate the cancer associated mutations of a protein, making it easy for someone to select and visualize the associated residue in a structure. Ideally, these annotations could be grouped and sorted. Even better, they could be linked to other resources. Thanks Melissa

2 2

Converting Chimera movie script
by Vid Sustar 26 Jun '20

26 Jun '20

The following bug report has been submitted: Platform: Linux-5.3.0-61-generic-x86_64-with-debian-buster-sid ChimeraX Version: 1.0 (2020-06-04 23:15:07 UTC) Description Hello! I have tried to adapt the cliping script from http://www.rbvi.ucsf.edu/chimera/data/movie-howto-mar2012/scripts/clip.cmd to work in ChimeraX (because my structure is too big, to be loaded properly in earlier Chimera) I tried to convert the old commands to the ChimeraX, but I get an error in the line "clip front -0.5 120": Expected a keyword Please advise me how to change the code to work with ChimeraX to create a movie or to simply save a series of images of cliped planes Best regards, Vid Sustar Log: UCSF ChimeraX version: 1.0 (2020-06-04) © 2016-2020 Regents of the University of California. All rights reserved. How to cite UCSF ChimeraX > open /home/user/MASTERS/Chimera_files/PythonScripts/clip2.py Traceback (most recent call last): File "/usr/lib/ucsf-chimerax/lib/python3.7/site- packages/chimerax/open_command/dialog.py", line 150, in _qt_safe if data_format is None else " format " + StringArg.unparse(data_format.nicknames[0]))) File "/usr/lib/ucsf-chimerax/lib/python3.7/site- packages/chimerax/core/commands/run.py", line 31, in run results = command.run(text, log=log) File "/usr/lib/ucsf-chimerax/lib/python3.7/site- packages/chimerax/core/commands/cli.py", line 2805, in run result = ci.function(session, **kw_args) File "/usr/lib/ucsf-chimerax/lib/python3.7/site- packages/chimerax/open_command/cmd.py", line 101, in cmd_open Command(session, registry=registry).run(provider_cmd_text, log=log) File "/usr/lib/ucsf-chimerax/lib/python3.7/site- packages/chimerax/core/commands/cli.py", line 2805, in run result = ci.function(session, **kw_args) File "/usr/lib/ucsf-chimerax/lib/python3.7/site- packages/chimerax/open_command/cmd.py", line 152, in provider_open name or model_name_from_path(fi.file_name)), provider_kw) File "/usr/lib/ucsf-chimerax/lib/python3.7/site- packages/chimerax/open_command/cmd.py", line 365, in collated_open return func(*func_args, **func_kw) File "/usr/lib/ucsf-chimerax/lib/python3.7/site- packages/chimerax/core_formats/__init__.py", line 48, in open return open_python_script(session, data, file_name) File "/usr/lib/ucsf-chimerax/lib/python3.7/site- packages/chimerax/core/scripting.py", line 82, in open_python_script _exec_python(session, code, argv) File "/usr/lib/ucsf-chimerax/lib/python3.7/site- packages/chimerax/core/scripting.py", line 59, in _exec_python exec(code, sandbox.__dict__) File "clip2.py", line 3, in <module> ModuleNotFoundError: No module named 'chimera' ModuleNotFoundError: No module named 'chimera' File "clip2.py", line 3, in See log for complete Python traceback. > ui tool show Shell /usr/lib/ucsf-chimerax/lib/python3.7/site- packages/IPython/core/history.py:226: UserWarning: IPython History requires SQLite, your history will not be saved warn("IPython History requires SQLite, your history will not be saved") > select up Nothing selected > open /home/user/MASTERS/Chimera_files/PythonScripts/clip2.py Traceback (most recent call last): File "/usr/lib/ucsf-chimerax/lib/python3.7/site- packages/chimerax/open_command/dialog.py", line 150, in _qt_safe if data_format is None else " format " + StringArg.unparse(data_format.nicknames[0]))) File "/usr/lib/ucsf-chimerax/lib/python3.7/site- packages/chimerax/core/commands/run.py", line 31, in run results = command.run(text, log=log) File "/usr/lib/ucsf-chimerax/lib/python3.7/site- packages/chimerax/core/commands/cli.py", line 2805, in run result = ci.function(session, **kw_args) File "/usr/lib/ucsf-chimerax/lib/python3.7/site- packages/chimerax/open_command/cmd.py", line 101, in cmd_open Command(session, registry=registry).run(provider_cmd_text, log=log) File "/usr/lib/ucsf-chimerax/lib/python3.7/site- packages/chimerax/core/commands/cli.py", line 2805, in run result = ci.function(session, **kw_args) File "/usr/lib/ucsf-chimerax/lib/python3.7/site- packages/chimerax/open_command/cmd.py", line 152, in provider_open name or model_name_from_path(fi.file_name)), provider_kw) File "/usr/lib/ucsf-chimerax/lib/python3.7/site- packages/chimerax/open_command/cmd.py", line 365, in collated_open return func(*func_args, **func_kw) File "/usr/lib/ucsf-chimerax/lib/python3.7/site- packages/chimerax/core_formats/__init__.py", line 48, in open return open_python_script(session, data, file_name) File "/usr/lib/ucsf-chimerax/lib/python3.7/site- packages/chimerax/core/scripting.py", line 82, in open_python_script _exec_python(session, code, argv) File "/usr/lib/ucsf-chimerax/lib/python3.7/site- packages/chimerax/core/scripting.py", line 59, in _exec_python exec(code, sandbox.__dict__) File "clip2.py", line 3, in <module> ModuleNotFoundError: No module named 'chimera' ModuleNotFoundError: No module named 'chimera' File "clip2.py", line 3, in See log for complete Python traceback. > open /home/user/MASTERS/Chimera_files/PythonScripts/writeMol2.py Traceback (most recent call last): File "/usr/lib/ucsf-chimerax/lib/python3.7/site- packages/chimerax/open_command/dialog.py", line 150, in _qt_safe if data_format is None else " format " + StringArg.unparse(data_format.nicknames[0]))) File "/usr/lib/ucsf-chimerax/lib/python3.7/site- packages/chimerax/core/commands/run.py", line 31, in run results = command.run(text, log=log) File "/usr/lib/ucsf-chimerax/lib/python3.7/site- packages/chimerax/core/commands/cli.py", line 2805, in run result = ci.function(session, **kw_args) File "/usr/lib/ucsf-chimerax/lib/python3.7/site- packages/chimerax/open_command/cmd.py", line 101, in cmd_open Command(session, registry=registry).run(provider_cmd_text, log=log) File "/usr/lib/ucsf-chimerax/lib/python3.7/site- packages/chimerax/core/commands/cli.py", line 2805, in run result = ci.function(session, **kw_args) File "/usr/lib/ucsf-chimerax/lib/python3.7/site- packages/chimerax/open_command/cmd.py", line 152, in provider_open name or model_name_from_path(fi.file_name)), provider_kw) File "/usr/lib/ucsf-chimerax/lib/python3.7/site- packages/chimerax/open_command/cmd.py", line 365, in collated_open return func(*func_args, **func_kw) File "/usr/lib/ucsf-chimerax/lib/python3.7/site- packages/chimerax/core_formats/__init__.py", line 48, in open return open_python_script(session, data, file_name) File "/usr/lib/ucsf-chimerax/lib/python3.7/site- packages/chimerax/core/scripting.py", line 82, in open_python_script _exec_python(session, code, argv) File "/usr/lib/ucsf-chimerax/lib/python3.7/site- packages/chimerax/core/scripting.py", line 59, in _exec_python exec(code, sandbox.__dict__) File "writeMol2.py", line 2, in <module> ModuleNotFoundError: No module named 'chimera' ModuleNotFoundError: No module named 'chimera' File "writeMol2.py", line 2, in See log for complete Python traceback. > help help:user > open /home/user/MASTERS/Chimera_files/PythonScripts/clip2.py Traceback (most recent call last): File "/usr/lib/ucsf-chimerax/lib/python3.7/site- packages/chimerax/open_command/dialog.py", line 150, in _qt_safe if data_format is None else " format " + StringArg.unparse(data_format.nicknames[0]))) File "/usr/lib/ucsf-chimerax/lib/python3.7/site- packages/chimerax/core/commands/run.py", line 31, in run results = command.run(text, log=log) File "/usr/lib/ucsf-chimerax/lib/python3.7/site- packages/chimerax/core/commands/cli.py", line 2805, in run result = ci.function(session, **kw_args) File "/usr/lib/ucsf-chimerax/lib/python3.7/site- packages/chimerax/open_command/cmd.py", line 101, in cmd_open Command(session, registry=registry).run(provider_cmd_text, log=log) File "/usr/lib/ucsf-chimerax/lib/python3.7/site- packages/chimerax/core/commands/cli.py", line 2805, in run result = ci.function(session, **kw_args) File "/usr/lib/ucsf-chimerax/lib/python3.7/site- packages/chimerax/open_command/cmd.py", line 152, in provider_open name or model_name_from_path(fi.file_name)), provider_kw) File "/usr/lib/ucsf-chimerax/lib/python3.7/site- packages/chimerax/open_command/cmd.py", line 365, in collated_open return func(*func_args, **func_kw) File "/usr/lib/ucsf-chimerax/lib/python3.7/site- packages/chimerax/core_formats/__init__.py", line 48, in open return open_python_script(session, data, file_name) File "/usr/lib/ucsf-chimerax/lib/python3.7/site- packages/chimerax/core/scripting.py", line 82, in open_python_script _exec_python(session, code, argv) File "/usr/lib/ucsf-chimerax/lib/python3.7/site- packages/chimerax/core/scripting.py", line 59, in _exec_python exec(code, sandbox.__dict__) File "clip2.py", line 4, in <module> ImportError: cannot import name 'runCommand' from 'chimerax' (unknown location) ImportError: cannot import name 'runCommand' from 'chimerax' (unknown location) File "clip2.py", line 4, in See log for complete Python traceback. > open /home/user/MASTERS/Chimera_files/PythonScripts/clip2.cxc > open /home/user/MASTERS/Chimera_files/testPDBfiles/Sys1nanopart.pdb > select :wat 157584 atoms, 157584 bonds, 1 model selected > hide sel target a > select ~sel 37869 atoms, 34860 bonds, 1 model selected > surface sel > color (#!1 & sel) white > select ::name="OQL" 2380 atoms, 2520 bonds, 1 model selected > color (#!1 & sel) red > select ::name="ONC" 4200 atoms, 3920 bonds, 1 model selected > color (#!1 & sel) blue > select ::name="NP" 2869 atoms, 1 model selected > color (#!1 & sel) yellow > lighting flat > lighting shadows false > graphics silhouettes false > movie record supersample 3 > clip front -0.5 > wait wait requires a frame count argument unless motion is in progress > movie encode clip.mp4 bitrate 200 Movie encoding failed because no images were recorded. > close session > open /home/user/MASTERS/Chimera_files/PythonScripts/clip2.cxc > open /home/user/MASTERS/Chimera_files/testPDBfiles/Sys1nanopart.pdb > select :wat 157584 atoms, 157584 bonds, 1 model selected > hide sel target a > select ~sel 37869 atoms, 34860 bonds, 1 model selected > surface sel > color (#!1 & sel) white > select ::name="OQL" 2380 atoms, 2520 bonds, 1 model selected > color (#!1 & sel) red > select ::name="ONC" 4200 atoms, 3920 bonds, 1 model selected > color (#!1 & sel) blue > select ::name="NP" 2869 atoms, 1 model selected > color (#!1 & sel) yellow > lighting flat > lighting shadows false > graphics silhouettes false > movie record supersample 3 > clip front -0.5 120 Expected a keyword > close session > open /home/user/MASTERS/Chimera_files/PythonScripts/clip2.cxc > open /home/user/MASTERS/Chimera_files/testPDBfiles/Sys1nanopart.pdb > select :wat 157584 atoms, 157584 bonds, 1 model selected > hide sel target a > select ~sel 37869 atoms, 34860 bonds, 1 model selected > surface sel > color (#!1 & sel) white > select ::name="OQL" 2380 atoms, 2520 bonds, 1 model selected > color (#!1 & sel) red > select ::name="ONC" 4200 atoms, 3920 bonds, 1 model selected > color (#!1 & sel) blue > select ::name="NP" 2869 atoms, 1 model selected > color (#!1 & sel) yellow > lighting flat > lighting shadows false > graphics silhouettes false > windowsize 200 150 > copy file clip.jpg Unknown command: copy file clip.jpg > copy Unknown command: copy > save /home/user/Desktop/image1.png supersample 3 > movie record Already recording a movie > open /home/user/Desktop/gbpmovie.cxc No such file/path: /home/user/Desktop/gbpmovie.cxc > close session > open /home/user/MASTERS/Chimera_files/PythonScripts/clip2.cxc > open /home/user/MASTERS/Chimera_files/testPDBfiles/Sys1nanopart.pdb > select :wat 157584 atoms, 157584 bonds, 1 model selected > hide sel target a > select ~sel 37869 atoms, 34860 bonds, 1 model selected > surface sel > color (#!1 & sel) white > select ::name="OQL" 2380 atoms, 2520 bonds, 1 model selected > color (#!1 & sel) red > select ::name="ONC" 4200 atoms, 3920 bonds, 1 model selected > color (#!1 & sel) blue > select ::name="NP" 2869 atoms, 1 model selected > color (#!1 & sel) yellow > lighting flat > lighting shadows false > graphics silhouettes false > movie record supersample 3 Already recording a movie > movie stop > movie record supersample 3 > movie stop > movie stop Not currently recording > close session > open /home/user/MASTERS/Chimera_files/PythonScripts/clip2.cxc > open /home/user/MASTERS/Chimera_files/testPDBfiles/Sys1nanopart.pdb > select :wat 157584 atoms, 157584 bonds, 1 model selected > hide sel target a > select ~sel 37869 atoms, 34860 bonds, 1 model selected > surface sel > color (#!1 & sel) white > select ::name="OQL" 2380 atoms, 2520 bonds, 1 model selected > color (#!1 & sel) red > select ::name="ONC" 4200 atoms, 3920 bonds, 1 model selected > color (#!1 & sel) blue > select ::name="NP" 2869 atoms, 1 model selected > color (#!1 & sel) yellow > lighting flat > lighting shadows false > graphics silhouettes false > movie record supersample 3 > clip front -0.5 120 ; wait 120 ; movie encode clip.mp4 bitrate 200 Expected a keyword > help help:contact.html OpenGL version: 3.3.0 NVIDIA 440.100 OpenGL renderer: GeForce RTX 2060/PCIe/SSE2 OpenGL vendor: NVIDIA Corporation Manufacturer: Micro-Star International Co., Ltd. Model: GL63 8SE OS: Ubuntu 18.04 bionic Architecture: 64bit ELF CPU: 12 Intel(R) Core(TM) i7-8750H CPU @ 2.20GHz Cache Size: 9216 KB Memory: total used free shared buff/cache available Mem: 31G 6.1G 18G 662M 6.6G 24G Swap: 2.0G 0B 2.0G Graphics: 00:02.0 VGA compatible controller [0300]: Intel Corporation Device [8086:3e9b] Subsystem: Micro-Star International Co., Ltd. [MSI] Device [1462:126a] Kernel driver in use: i915 PyQt version: 5.12.3 Compiled Qt version: 5.12.4 Runtime Qt version: 5.12.8 File attachment: clip2.cxc

3 2

chimerax label bug
by Lukas Kater 26 Jun '20

26 Jun '20

Hi ChimeraX developers, I have been tryinng to use 2dlabel to annotate some things in a movie. I have stumbled accross a number of problems: 1) creating 2 labels with the same name causes a crasH: 2dlab create ADP text "ADP state" color black size 26 bold true xpos 0.03 ypos 0.92 visibility false 2dlab create ADP text "ADP state" color black size 26 bold true xpos 0.03 ypos 0.92 visibility false

2 3

Local resolution legend
by Tetter Stephan 25 Jun '20

25 Jun '20

Dear ChimeraX Users and Developers, I manage to color my cryoEM maps by local resolution, but can't figure out how to display a scale bar of the color code. Any ideas? Or do I have to go back to Chimera for this? Thanks, Stephan

4 4

Morph cryoEM maps result
by Aritz Roa Eguiara 25 Jun '20

25 Jun '20

Dear ChimeraX team, This is probably a previously discussed topic but I have not managed to find it specifically anywhere. So I am trying to morph a couple of maps on ChimeraX using the volume morph command, but I do not get any slider as it happens with the atom model morphing (as far as I understand there is not option for that?) Also, once I do it I get a model that is called morph that if I run the movie is recorded but I cannot bounce or control any further, is it like a one time use command that then only leaves that model result of the last frame that cannot be used anymore? Best regards, Aritz

2 2

CIF writer renumbers residues
by Daniel Asarnow 23 Jun '20

23 Jun '20

Hi all, When I save a CIF from ChimeraX (while using ISOLDE), the warning "Not saving entity_poly_seq for non-authoritative sequences" is produced, and all the residues have been sequentially renumbered from 1. When there are missing residues, each segment has to be renumbered manually afterwards. Is there some way to avoid this with PDB or CIF inputs? Is it a bug? Best, -da

5 6

Re: [chimerax-users] Antw: [EXT] Re: selection modes
by Elaine Meng 23 Jun '20

23 Jun '20

> From: "Philipp Milkereit" <Philipp.Milkereit(a)vkl.uni-regensburg.de> > Subject: Antw: Re: [chimerax-users] Antw: [EXT] Re: selection modes > Date: June 18, 2020 at 9:06:02 AM PDT > To: <meng(a)cgl.ucsf.edu> > > Hi Elaine > just a follow-up question on the Select Menu_Mode:Add, do you think it could make sense to apply this mode also to user-defined names listed in the Basic Actions window? That seems at the moment neither in ChimeraX 0.93 nor in 1.0 the case, but could be an easy way to add fast a bunch of named selections to the current selection. Also for the subtract/intersect modes that might be an interesting option? > > best wishes, > > Philipp > >>> Elaine Meng <meng(a)cgl.ucsf.edu> 18.06.2020 17:33 >>> > Hi Philipp, > I don't think there is an ISOLDE for 1.0 yet. If I look at the toolshed it says ISOLDE 1.05b "works with 0.93" > > <https://cxtoolshed.rbvi.ucsf.edu/apps/chimeraxisolde <https://cxtoolshed.rbvi.ucsf.edu/apps/chimeraxisolde>> > > Best, > Elaine > ----- > Elaine C. Meng, Ph.D. > UCSF Chimera(X) team > Department of Pharmaceutical Chemistry > University of California, San Francisco > > > On Jun 18, 2020, at 1:18 AM, Philipp Milkereit <Philipp.Milkereit(a)vkl.uni-regensburg.de> wrote: > > > > Dear Elaine, > > > > thanks for your help! > > Your example does not work for me on ChimeraX 0.93 (2020-04-03) both on a Windows and a Linux sytem. But after installing the new production version 1.0 the selection mode works indeed there on user defined selectors as expected, which is great! > > Apparently there should be also now versions of the Isolde plugin (1.0b5 ?) which are compatible with ChimeraX 1.0, so no reason anymore to stay with 0.93.. > > > > Best, > > > > Philipp > > >>> Elaine Meng <meng(a)cgl.ucsf.edu> 18.06.2020 01:15 >>> > > Hi Philipp, > > This works fine for me using the menu. For example, start ChimeraX, then: > > > > open 2gbp > > menu: Select... Structure... Secondary Structure... Strand > > menu: Select... Define Selector... (I gave it the name "mystrands") > > menu: Select... Clear > > menu: Select... Structure... Ligand > > menu: Select... Menu Mode... Add > > menu: Select... User-Defined Selectors... mystrands > > > > Now both the ligand and strands are selected. Also works if I use commands for any of those steps. When you use the menu, the corresponding commands are echoed in the Log, and it actually works by running the commands, so it doesn't make sense that commands would work and the menu wouldn't. > > > > Tested in version 1.0. > > > > I hope this helps, > > Elaine > > ----- > > Elaine C. Meng, Ph.D. > > UCSF Chimera(X) team > > Department of Pharmaceutical Chemistry > > University of California, San Francisco > > > > > > > On Jun 17, 2020, at 1:11 PM, Philipp Milkereit <philipp.milkereit(a)vkl.uni-regensburg.de> wrote: > > > > > > Dear all, > > > > > > is there a way to add user-defined selectors or named selections (command: name) to the current selection by choosing them from the Menu:Select or in the Basic Actions window? Changing to Menu_Mode:Add in Menu:Select seems not to have any effect on that. I think in Chimera1 named selections still could be added to the current selection using the „append“ selection mode. At the moment adding named selections to the current selection works for me in ChimeraX just with the command line „select add“ command. > > > > > > Many thanks for your help, > > > > > > Philipp Milkereit

3 3

Re: [chimerax-users] [Chimera-users] convert .mod to .mrc
by Elaine Meng 23 Jun '20

23 Jun '20

Dear Emmanuel Moebel, I can't think of a simple way to make an index map from IMOD meshes, only a multistep process for each mesh object. At first I misread the question and thought you said "ChimeraX" so below are steps for both Chimera and ChimeraX in case anybody might be interested. I have not tried the entire process, however. I hope this helps, Elaine =-=-= The following instructions are for Chimera: Each IMOD mesh object from the file is a surface piece. <http://www.rbvi.ucsf.edu/chimera/docs/ContributedSoftware/volumeviewer/imod…> You can specify that surface piece in a "mask" command as "sel" (after selecting it with the mouse) and specifying input map as "ones" to create a map that has values of 1 inside, 0 outside. Then you can scale the map by using "vop scale" to multiply values by a constant (e.g. for values of 2 or 3 instead): <http://www.rbvi.ucsf.edu/chimera/docs/UsersGuide/midas/mask.html> <http://www.rbvi.ucsf.edu/chimera/docs/UsersGuide/midas/vop.html#scale> Maybe if you did this for multiple mesh objects you could combine the results into one map with "vop add"; not sure how well this would work. <http://www.rbvi.ucsf.edu/chimera/docs/UsersGuide/midas/vop.html#add> Then you can save your index map as MRC using the Volume Viewer File menu or command "volume" <http://www.rbvi.ucsf.edu/chimera/docs/ContributedSoftware/volumeviewer/volu…> =-=-= The following instructions are for ChimeraX. Each IMOD mesh object from the file is a surface model in ChimeraX. <http://rbvi.ucsf.edu/chimerax/docs/user/formats/imod.html> You can specify that surface model in a "volume onesmask" command to create a map that has values of 1 inside, 0 outside, then multiply values by a constant (e.g. for values of 2 or 3 instead) using "volume scale": <http://rbvi.ucsf.edu/chimerax/docs/user/commands/volume.html#onesmask> <http://rbvi.ucsf.edu/chimerax/docs/user/commands/volume.html#scale> Maybe if you did this for multiple mesh objects you could combine the results into one map with "volume add"; not sure how well this would work. <http://rbvi.ucsf.edu/chimerax/docs/user/commands/volume.html#add> Then you can use "save" to write your index map as MRC: <http://rbvi.ucsf.edu/chimerax/docs/user/commands/save.html#map> I hope this helps, Elaine ----- Elaine C. Meng, Ph.D. UCSF Chimera(X) team Department of Pharmaceutical Chemistry University of California, San Francisco > On Jun 23, 2020, at 7:00 AM, Emmanuel Moebel <emmanuel.moebel(a)inria.fr> wrote: > > Dear Chimera community, > > I am visualising a tomogram segmentation with Chimera, the format of the file is .mod and has been obtained with the IMOD software. I would like to get a voxel map from it : a volume with integer values, for ex. '0' for background, '1' for membrane, '2' for filament. Output file format needs to be .mrc or .em. Is this possible to achieve with Chimera? > > Thanks in advance, > Emmanuel Moebel, PhD

1 0

select model Z-translate
by 张佳星 23 Jun '20

23 Jun '20

Dear all， How can i do select model Z-translate use mouse? like command move z distance models when i click toolbar- Right Mouse-Move model,selected one model,scroll the mouse +right mouse ,all model will zoom Many thanks for your help, Jiaxing Zhang

2 1

Re: [chimerax-users] [Chimera-users] Structure Minimization and Molecule Movement (ChimeraX-1.0)?
by Elaine Meng 20 Jun '20

20 Jun '20

Dear Ammar, For future reference, for ChimeraX questions it is better to use the chimerax-users(a)cgl.ucsf.edu mailing list instead of this one. We announced ChimeraX on both "announce" lists, however, because we thought Chimera users would want to know about it. (1) Moving only a subset of atoms. In ChimeraX, the way to move only a subset of the models or the atoms with the mouse is to assign the mouse to move only the selected models or atoms, then select the atoms of interest, and then move them with the mouse. For example, all of the icons in the "Right Mouse" tab of the toolbar represent different modes, and clicking an icon assigns that function to the right mouse button ( = trackpad + Alt on Windows, trackpad + command key on a Mac). Click the icon that looks like a blue sphere with arrows around it to assign the right mouse button to "move selected atoms." Then dragging with the right mouse button (or trackpad equivalent) will translate the selected atoms and additionally pressing Shift will rotate the selected atoms. Right Mouse icons and what they mean: <http://rbvi.ucsf.edu/chimerax/docs/user/tools/mousemodes.html> Similar between Chimera and ChimeraX: there are multiple possible ways to select the ligand, e.g. choosing its residue name from menu: Select... Residue... [residue name], or Ctrl-clicking on one of its atoms and then pressing the keyboard up arrow key to promote the selection to the whole residue. <http://rbvi.ucsf.edu/chimerax/docs/user/menu.html#select> <http://rbvi.ucsf.edu/chimerax/docs/user/selection.html> Although the Right Mouse icons only assign functions to the right mouse button, with the "mousemode" command, you can assign any of these functions to any mouse button alone or in combination with modifier keys. <http://rbvi.ucsf.edu/chimerax/docs/user/commands/ui.html#mousemode> (2) There is no minimize structure tool in ChimeraX currently. There are limited local "jiggling" calculations with the "tug" and "minimize" mouse modes but only for structures with only standard biopolymer residues and water, not ligands in general: <http://rbvi.ucsf.edu/chimerax/docs/user/tools/mousemodes.html> .... and more extensive molecular dynamics capabilities with the ISOLDE plugin for refinement/modeling into density maps: <https://isolde.cimr.cam.ac.uk/what-isolde/> I hope this helps, Elaine ----- Elaine C. Meng, Ph.D. UCSF Chimera(X) team Department of Pharmaceutical Chemistry University of California, San Francisco > On Jun 20, 2020, at 6:18 PM, Ammar Jastaniah <ajasta2(a)uic.edu> wrote: > > Hi, > I am not able to find the minimize feature function in ChimeraX-1.0. Is there an equivalent to the regular Chimera version, which is to be found under Tools ==> Structure Editing ===> Minimize Structure? > > Also. Are you able to move a PDB file ligand molecule around while keeping the other receptor PDB structure stationary/in its place in ChimeraX-1.0? Once again, this is achievable in Chimera by clicking on Tools ==> Movement ===> Movement Mouse Mode. > Thank you. > Ammar

1 0

ViewDock script
by Moustafa, Ibrahim M. 19 Jun '20

19 Jun '20

Dear All, I'm trying to run ViewDock from a script using the following command in a loop: runCommand("viewdock " + filename + " AutoDock") It works fine. However, the ViewDock window remains opened after reading each file. For large number of files it is not practical to close them manually. Is there a command to close the opened ViewDock windows to add to the script? Thank you for your help. Ibrahim

3 4

RMSD command in ChimeraX
by Hrvoje Rimac 19 Jun '20

19 Jun '20

Hi, I was wondering if there is a command in ChimeraX which calculates RMSD without first aligning the ligands (analog to Chimera command "rmsd"). The problem is that the order of atoms in the two pdb files is not identical, and in Chimera (1.14) the "rmsd" command (as well as the "match" command) compares the first atom to the first atom, the second to the second etc, regardless of their type (I checked this manually), so the calculated RMSD is very high. In ChimeraX this mismatching problem is resolved, however the only command I found was the "align" command which calculates RMSD after aligning the molecules (as "match" match does in Chimera). Is there a command that would calculate RMSD without aligning the molecules? This wouldn't be a problem if I had 2 ligands to compare, but since I have more than 900, it would be very time consuming to check and correct order of all atoms. P.S. I have attached the structures of the two ligands. The RMSD values I'm getting are: Chimera "match": 4.064 Chimera "rmsd": 4.147 ChimeraX "align": 0.252 The value I should get: 0.454 Best regards, Hrvoje Rimac Hrvoje Rimac, PhD. Postdoctoral Fellow Department of Medicinal Chemistry Faculty of Pharmacy and Biochemistry University of Zagreb A.Kovačića 1, 10000 Zagreb Croatia http://www.pharma.unizg.hr/

4 7

ChimeraX: mmcif connectivity lost in some chains; OK in Coot
by Anderson, Jacob 18 Jun '20

18 Jun '20

Dear ChimeraX team, Thank you very much for your work on this great software. We use it daily, and without which it would be extremely difficult to articulate our science. I am touching base with a problem I am having after migrating from a pdb --> mmcif format.For context, I am running ChimeraX on Ubuntu 20.04 using a fresh deb install this morning: chimerax --version UCSF ChimeraX version: 1.0 (2020-06-04) © 2016-2020 Regents of the University of California. All rights reserved. To be explicit, my problem is entirely reproducible. Specifically, I have a file (attached) that when opened in ccpem's Coot v0.9-pre, has all the connectivity present. However, when I switch to ChimeraX, the connectivity of some chains are lost. A good example of this contrast on chain connectivity fidelity is chain LA and LB. (photo attached). I tried reading through the ChimeraX documentation on this CIF format,<https://www.rbvi.ucsf.edu/chimerax/docs/devel/bundles/mmcif/src/mmcif_guide…> but it remained not totally clear to me what is going awry in some chains but not in others. If you might have any insight on how to overcome this problem in chimerax, and allow all the chains to remain their connectivity, I would very much appreciate your thoughts/wisdom on the topic. ~Jacob [cid:0f6782e1-eb79-43db-93e8-0f8f44417fb3]

3 5

Antw: [EXT] Re: selection modes
by Philipp Milkereit 18 Jun '20

18 Jun '20

Dear Elaine, thanks for your help! Your example does not work for me on ChimeraX 0.93 (2020-04-03) both on a Windows and a Linux sytem. But after installing the new production version 1.0 the selection mode works indeed there on user defined selectors as expected, which is great! Apparently there should be also now versions of the Isolde plugin (1.0b5 ?) which are compatible with ChimeraX 1.0, so no reason anymore to stay with 0.93.. Best, Philipp >>> Elaine Meng <meng(a)cgl.ucsf.edu> 18.06.2020 01:15 >>> Hi Philipp, This works fine for me using the menu. For example, start ChimeraX, then: open 2gbp menu: Select... Structure... Secondary Structure... Strand menu: Select... Define Selector... (I gave it the name "mystrands") menu: Select... Clear menu: Select... Structure... Ligand menu: Select... Menu Mode... Add menu: Select... User-Defined Selectors... mystrands Now both the ligand and strands are selected. Also works if I use commands for any of those steps. When you use the menu, the corresponding commands are echoed in the Log, and it actually works by running the commands, so it doesn't make sense that commands would work and the menu wouldn't. Tested in version 1.0. I hope this helps, Elaine ----- Elaine C. Meng, Ph.D. UCSF Chimera(X) team Department of Pharmaceutical Chemistry University of California, San Francisco > On Jun 17, 2020, at 1:11 PM, Philipp Milkereit <philipp.milkereit(a)vkl.uni-regensburg.de> wrote: > > Dear all, > > is there a way to add user-defined selectors or named selections (command: name) to the current selection by choosing them from the Menu:Select or in the Basic Actions window? Changing to Menu_Mode:Add in Menu:Select seems not to have any effect on that. I think in Chimera1 named selections still could be added to the current selection using the „append“ selection mode. At the moment adding named selections to the current selection works for me in ChimeraX just with the command line „select add“ command. > > Many thanks for your help, > > Philipp Milkereit >

2 1

selection modes
by Philipp Milkereit 17 Jun '20

17 Jun '20

Dear all, is there a way to add user-defined selectors or named selections (command: name) to the current selection by choosing them from the Menu:Select or in the Basic Actions window? Changing to Menu_Mode:Add in Menu:Select seems not to have any effect on that. I think in Chimera1 named selections still could be added to the current selection using the "append" selection mode. At the moment adding named selections to the current selection works for me in ChimeraX just with the command line "select add" command. Many thanks for your help, Philipp Milkereit

2 1

Re: [chimerax-users] ChimeraX troubleshooting
by Tom Goddard 17 Jun '20

17 Jun '20

Hi Joseph, Ok, it is complaining about a ChimeraX preference file C:\Users\Joseph\AppData\Local\UCSF\ChimeraX\ui-1 that saves your last ChimeraX window size (which is used when you start ChimeraX the next time), and saves any tools you added to the Favorites menu. It is supposed to be a text file but yours somehow contains all binary 0. Could you send us that ui-1 file, then delete it, and hopefully ChimeraX will start if there are no other problems. I will open a bug report and we will look at how this happened and probably put in some code so that if a preference file is unreadable ChimeraX will still start and just warn you about the corrupted file. You will get an email about that bug report and it would help if you could reply to that email with the ui-1 file as an attachment to help us debug the problem. Tom > On Jun 17, 2020, at 2:03 PM, Joseph Chamieh <joseph.chamieh(a)umontpellier.fr> wrote: > > Dear Tom > Thank you for your answer, this is the result of what you asked for: > > C:\>"C:\Program Files\ChimeraX 1.0\bin\ChimeraX-console.exe" --debug > C:\Program Files\ChimeraX 1.0\bin\lib\site-packages\win32\lib\pywintypes.py:2: DeprecationWarning: the imp module is deprecated in favour of importlib; see the module's documentation for alternative uses > import imp, sys, os > Traceback (most recent call last): > File "C:\Program Files\ChimeraX 1.0\bin\lib\runpy.py", line 193, in _run_module_as_main > "__main__", mod_spec) > File "C:\Program Files\ChimeraX 1.0\bin\lib\runpy.py", line 85, in _run_code > exec(code, run_globals) > File "C:\Program Files\ChimeraX 1.0\bin\lib\site-packages\ChimeraX_main.py", line 895, in <module> > exit_code = init(sys.argv) > File "C:\Program Files\ChimeraX 1.0\bin\lib\site-packages\ChimeraX_main.py", line 502, in init > sess.ui = ui_class(sess) > File "C:\Program Files\ChimeraX 1.0\bin\lib\site-packages\chimerax\ui\gui.py", line 110, in __init__ > self.settings = UI_Settings(session, "ui") > File "C:\Program Files\ChimeraX 1.0\bin\lib\site-packages\chimerax\core\settings.py", line 165, in __init__ > ConfigFile.__init__(self, session, tool_name, version=version) > File "C:\Program Files\ChimeraX 1.0\bin\lib\site-packages\chimerax\core\configfile.py", line 289, in __init__ > self._config.read(self._filename, encoding='utf-8') > File "C:\Program Files\ChimeraX 1.0\bin\lib\configparser.py", line 696, in read > self._read(fp, filename) > File "C:\Program Files\ChimeraX 1.0\bin\lib\configparser.py", line 1079, in _read > raise MissingSectionHeaderError(fpname, lineno, line) > configparser.MissingSectionHeaderError: File contains no section headers. > file: 'C:\\Users\\Joseph\\AppData\\Local\\UCSF\\ChimeraX\\ui-1', line: 1 > '\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00' > > I remain at your disposal for any further information > Best regards > Joseph > > > _____________________________________________________________________ > Joseph Chamieh, PhD, HDR > Institut des Biomolécules Max Mousseron, UMR CNRS 5247, > Université de Montpellier, > Place Eugène Bataillon, case courrier 1706, > F-34095 Montpellier Cedex 5, France > Phone: +33 4 67 14 39 20 > Fax: +33 4 67 63 10 46 > http://www.dsbc.univ-montp2.fr/recherche_en.html <http://www.dsbc.univ-montp2.fr/recherche_en.html> > http://orcid.org/0000-0003-4209-1337 <http://orcid.org/0000-0003-4209-1337> > ______________________________________________________________________ > > De : Tom Goddard [mailto:goddard@sonic.net] > Envoyé : Wednesday, June 17, 2020 7:01 PM > À : Joseph Chamieh <joseph.chamieh(a)umontpellier.fr> > Cc : chimerax-users(a)cgl.ucsf.edu > Objet : Re: [chimerax-users] ChimeraX troubleshooting > > Hi Joseph, > > To see why ChimeraX is failing to start on Windows, run it from a Windows Command Prompt as follows (two dashes in --debug) > > "C:\Program Files\ChimeraX 1.0\bin\ChimeraX-console.exe" --debug > > and send us the error message this gives. > > Tom > > > >> On Jun 17, 2020, at 1:51 AM, Joseph Chamieh <joseph.chamieh(a)umontpellier.fr <mailto:joseph.chamieh@umontpellier.fr>> wrote: >> >> Dear ChimeraX developers, >> First I would like to thank you for your wonderful job. I was looking for a software able to modelize my peptide in 3D and do all the calculations on it and I found ChimeraX yesterday, I downloaded and installed the software and directly found it as the best answer for my “problems”, however it worked in the morning and after a restarting of my laptop on midday, I was not able to start the software, so I uninstalled/reinstalled, I restarted again but since then I could not find the solution, I use an HP laptop Win 10 64 bit, I attached the dxdiag summary. >> I would appreciate it if you could help me find the solution. >> Best regards >> Joseph >> >> _____________________________________________________________________ >> Joseph Chamieh, PhD, HDR >> Institut des Biomolécules Max Mousseron, UMR CNRS 5247, >> Université de Montpellier, >> Place Eugène Bataillon, case courrier 1706, >> F-34095 Montpellier Cedex 5, France >> Phone: +33 4 67 14 39 20 >> Fax: +33 4 67 63 10 46 >> http://www.dsbc.univ-montp2.fr/recherche_en.html <http://www.dsbc.univ-montp2.fr/recherche_en.html> >> http://orcid.org/0000-0003-4209-1337 <http://orcid.org/0000-0003-4209-1337> >> ______________________________________________________________________ >> >> <DxDiag.txt>_______________________________________________ >> ChimeraX-users mailing list >> ChimeraX-users(a)cgl.ucsf.edu <mailto:ChimeraX-users@cgl.ucsf.edu> >> Manage subscription: >> https://www.rbvi.ucsf.edu/mailman/listinfo/chimerax-users <https://www.rbvi.ucsf.edu/mailman/listinfo/chimerax-users>

1 0

maximized on startup
by Anthony James Schaefer 17 Jun '20

17 Jun '20

Hello, Would it be possible to add an option for the ChimeraX app to be maximized on startup? I've got the window size set to 'last used' and I almost always maximize ChimeraX. With this combo, ChimeraX starts out the size of my screen, but not maximized. Thanks, Tony

2 4

operation (rotation and translation) marix relative to the original PDB
by Steve Chou 17 Jun '20

17 Jun '20

Dear ChimeraX developers and users, After we load a 3D molecule [model (pdb) or map (mrc)] into ChimeraX, we turn (rotate) and move (translate) the molecule to find out a nice orientation to print the image. How to write out and read in the operation/manipulation matrix (rotation matrix, 3x3; translation vector, 3x1; or their combination, 4x4) relative to the original orientation/coordinates in ChimeraX? Many thanks in advance! Steve -- Steve Chou

2 1

ChimeraX troubleshooting
by Joseph Chamieh 17 Jun '20

17 Jun '20

Dear ChimeraX developers, First I would like to thank you for your wonderful job. I was looking for a software able to modelize my peptide in 3D and do all the calculations on it and I found ChimeraX yesterday, I downloaded and installed the software and directly found it as the best answer for my problems, however it worked in the morning and after a restarting of my laptop on midday, I was not able to start the software, so I uninstalled/reinstalled, I restarted again but since then I could not find the solution, I use an HP laptop Win 10 64 bit, I attached the dxdiag summary. I would appreciate it if you could help me find the solution. Best regards Joseph _____________________________________________________________________ Joseph Chamieh, PhD, HDR Institut des Biomolécules Max Mousseron, UMR CNRS 5247, Université de Montpellier, Place Eugène Bataillon, case courrier 1706, F-34095 Montpellier Cedex 5, France Phone: +33 4 67 14 39 20 Fax: +33 4 67 63 10 46 <http://www.dsbc.univ-montp2.fr/recherche_en.html> http://www.dsbc.univ-montp2.fr/recherche_en.html <http://orcid.org/0000-0003-4209-1337> http://orcid.org/0000-0003-4209-1337 ______________________________________________________________________

2 1

Re: [chimerax-users] ChimeraX markers to IMOD model
by Tom Goddard 17 Jun '20

17 Jun '20

Hi Joe, I made ChimeraX able to read IMOD model files (same as in Chimera), in the current ChimeraX daily build. This does not help with your problem of marking particles for subtomogram averaging. As I added IMOD model reading I looked at whether ChimeraX could write such a file. The file has Fortran binary records and while I could write a file that ChimeraX would read, I am not sure whether IMOD or any other software would read it because the file has lots of information and I don't know what is required and what is optional. Tom > On Jun 17, 2020, at 7:35 AM, Atherton, Joseph <joseph.atherton(a)kcl.ac.uk> wrote: > > Thanks Tom > > Dr Joe Atherton > Lecturer in Cryo-electron Microscopy > Randall Centre for Cell and Molecular Biophysics > King's College London, UK > Email: joseph.atherton(a)kcl.ac.uk <mailto:joseph.atherton@kcl.ac.uk> > Tel: (+44) 0207 836 5454 > https://kclpure.kcl.ac.uk/portal/joseph.atherton.html <https://kclpure.kcl.ac.uk/portal/joseph.atherton.html> > From: Tom Goddard <goddard(a)sonic.net> > Sent: 16 June 2020 17:54 > To: Atherton, Joseph <joseph.atherton(a)kcl.ac.uk> > Cc: chimerax-users(a)cgl.ucsf.edu <chimerax-users(a)cgl.ucsf.edu> > Subject: Re: [chimerax-users] ChimeraX markers to IMOD model > > Hi Joe, > > Neither Chimera nor ChimeraX can write IMOD model files. (Chimera can read those files but that is not available in ChimeraX yet.) So I don't know how you could get ChimeraX markers (which are written as an XML .cmm file) into an IMOD model. > > Tom > > >> On Jun 16, 2020, at 7:04 AM, Atherton, Joseph <joseph.atherton(a)kcl.ac.uk <mailto:joseph.atherton@kcl.ac.uk>> wrote: >> >> Hi, >> >> I'd like to use the markers function in ChimeraX to make an IMOD 'model' for use in PEET for subtomogram averaging. ChimeraX's 'planes' function makes it a convenient program for doing this. Is such an export/conversion possible? >> >> All the best, >> Joe >> >> Dr Joe Atherton >> Lecturer in Cryo-electron Microscopy >> Randall Centre for Cell and Molecular Biophysics >> King's College London, UK >> Email: joseph.atherton(a)kcl.ac.uk <mailto:joseph.atherton@kcl.ac.uk> >> Tel: (+44) 0207 836 5454 >> https://kclpure.kcl.ac.uk/portal/joseph.atherton.html <https://eur03.safelinks.protection.outlook.com/?url=https%3A%2F%2Fkclpure.k…>_______________________________________________ >> ChimeraX-users mailing list >> ChimeraX-users(a)cgl.ucsf.edu <mailto:ChimeraX-users@cgl.ucsf.edu> >> Manage subscription: >> https://www.rbvi.ucsf.edu/mailman/listinfo/chimerax-users <https://eur03.safelinks.protection.outlook.com/?url=https%3A%2F%2Fplato.cgl…>

1 0

ChimeraX markers to IMOD model
by Atherton, Joseph 16 Jun '20

16 Jun '20

Hi, I'd like to use the markers function in ChimeraX to make an IMOD 'model' for use in PEET for subtomogram averaging. ChimeraX's 'planes' function makes it a convenient program for doing this. Is such an export/conversion possible? All the best, Joe Dr Joe Atherton Lecturer in Cryo-electron Microscopy Randall Centre for Cell and Molecular Biophysics King's College London, UK Email: joseph.atherton(a)kcl.ac.uk Tel: (+44) 0207 836 5454 https://kclpure.kcl.ac.uk/portal/joseph.atherton.html

2 1

Re: [chimerax-users] ChimeraX does not start after installation
by Tom Goddard 15 Jun '20

15 Jun '20

Hi Józef, OpenGL provides no mechanism for an applications to choose among multiple GPUs, or even know that multiple GPUs are available. It is up to your operating system to choose the GPU. Tom > On Jun 15, 2020, at 10:59 AM, Lewandowski, Jozef <J.R.Lewandowski(a)warwick.ac.uk> wrote: > > Hi Tom, > > Thanks. This is weird because I have recently updated to the latest NVidia drivers, which should have fixed this (and it didn't). I have been searching around based on your pointers and I suspect that Windows somehow tells ChimeraX to use the integrated graphics rather than one of the four NVidia GPUs (I guess Intel graphics is the GPU default in the Win installation) I have never checked or tried to update the driver for the integrated graphics so it might be that it is using some ancient generic driver (I just assumed that Windows would automatically directed ChimeraX to the more powerful GPU options). > I have found some instructions to force ChimeraX to use NVidia GPUs so I will try this (when I can access my workstation again). > > Best, > Józef > From: Tom Goddard <goddard(a)sonic.net> > Sent: Monday, June 15, 2020 5:46 PM > To: Lewandowski, Jozef <J.R.Lewandowski(a)warwick.ac.uk> > Cc: ChimeraX Users Help <chimerax-users(a)cgl.ucsf.edu> > Subject: Re: [chimerax-users] ChimeraX does not start after installation > > Hi Józef, > > The reason ChimeraX does not start on hour Windows computer is given in the middle of this error message: > > ERROR: ChimeraX requires OpenGL graphics version 3.3. > Your computer graphics driver provided version 1.1 > > Your OpenGL graphics driver is not working. Version 1.1 is from the 1990s and is what Windows gives you when you have no working graphics driver. So the fix will be to install a working graphics driver. > > When ChimeraX does not get a usable graphics driver it is supposed to still start and present a message explaining this. I am not sure why it crashed in your case. But I see in your error message > > Windows fatal exception: code 0x80000003 > > and searching online this says you have misconfigured Windows system files. All the top hits when searching for that error look like scams telling you how to use their special utility to "fix" your system. Be cautious -- I would not suggest running any spacial "cleaner" tools as they are usually malware. > > > Tom > >> On Jun 14, 2020, at 9:54 AM, Lewandowski, Jozef <J.R.Lewandowski(a)warwick.ac.uk <mailto:J.R.Lewandowski@warwick.ac.uk>> wrote: >> >> Hi Tom, >> >> I finally got to run ChimeraX-console with --debug (did not have access to the machine during lockdown) to see why ChimeraX does not start on my system. I am pasting the output below message. Can you give me any pointers on how to make my ChimeraX installation to work. From a cursory look it seems there is a problem with OpenGL implementation. >> Any tips would be welcome. I had latest Nvidia studio drivers, now I updated to the latest Nvidia gaming drivers and the problem with starting ChimeraX persists. >> >> Thanks, >> Józef >> >> Starting main interface >> [15380:7256:0608/122433.144:ERROR:gl_surface_wgl.cc <http://gl_surface_wgl.cc/>(391)] wglCreatePbufferARB not available. >> [15380:7256:0608/122433.144:ERROR:gl_surface_qt.cpp(200)] Requested OpenGL implementation is not supported. Implementation: 1 >> Windows fatal exception: code 0x80000003 >> >> Thread 0x000010d4 (most recent call first): >> File "C:\Program Files\ChimeraX 1.0\bin\lib\ssl.py", line 1139 in do_handshake >> File "C:\Program Files\ChimeraX 1.0\bin\lib\ssl.py", line 870 in _create >> File "C:\Program Files\ChimeraX 1.0\bin\lib\ssl.py", line 423 in wrap_socket >> File "C:\Program Files\ChimeraX 1.0\bin\lib\http\client.py", line 1422 in connect >> File "C:\Program Files\ChimeraX 1.0\bin\lib\http\client.py", line 966 in send >> File "C:\Program Files\ChimeraX 1.0\bin\lib\http\client.py", line 1026 in _send_output >> File "C:\Program Files\ChimeraX 1.0\bin\lib\http\client.py", line 1247 in endheaders >> File "C:\Program Files\ChimeraX 1.0\bin\lib\http\client.py", line 1298 in _send_request >> File "C:\Program Files\ChimeraX 1.0\bin\lib\http\client.py", line 1252 in request >> File "C:\Program Files\ChimeraX 1.0\bin\lib\urllib\request.py", line 1319 in do_open >> File "C:\Program Files\ChimeraX 1.0\bin\lib\urllib\request.py", line 1362 in https_open >> File "C:\Program Files\ChimeraX 1.0\bin\lib\urllib\request.py", line 503 in _call_chain >> File "C:\Program Files\ChimeraX 1.0\bin\lib\urllib\request.py", line 543 in _open >> File "C:\Program Files\ChimeraX 1.0\bin\lib\urllib\request.py", line 525 in open >> File "C:\Program Files\ChimeraX 1.0\bin\lib\urllib\request.py", line 222 in urlopen >> File "C:\Program Files\ChimeraX 1.0\bin\lib\site-packages\chimerax\core\toolshed\available.py", line 37 in load >> File "C:\Program Files\ChimeraX 1.0\bin\lib\site-packages\chimerax\core\toolshed\__init__.py", line 444 in reload_available >> File "C:\Program Files\ChimeraX 1.0\bin\lib\threading.py", line 870 in run >> File "C:\Program Files\ChimeraX 1.0\bin\lib\threading.py", line 926 in _bootstrap_inner >> File "C:\Program Files\ChimeraX 1.0\bin\lib\threading.py", line 890 in _bootstrap >> >> Thread 0x00001c4c (most recent call first): >> File "C:\Program Files\ChimeraX 1.0\bin\lib\site-packages\chimerax\ui\gui.py", line 879 in _populate_menus >> File "C:\Program Files\ChimeraX 1.0\bin\lib\site-packages\chimerax\ui\gui.py", line 458 in __init__ >> File "C:\Program Files\ChimeraX 1.0\bin\lib\site-packages\chimerax\ui\gui.py", line 196 in build >> File "C:\Program Files\ChimeraX 1.0\bin\lib\site-packages\ChimeraX_main.py", line 617 in init >> File "C:\Program Files\ChimeraX 1.0\bin\lib\site-packages\ChimeraX_main.py", line 895 in <module> >> File "C:\Program Files\ChimeraX 1.0\bin\lib\runpy.py", line 85 in _run_code >> File "C:\Program Files\ChimeraX 1.0\bin\lib\runpy.py", line 193 in _run_module_as_main >> ERROR: ChimeraX requires OpenGL graphics version 3.3. >> Your computer graphics driver provided version 1.1 >> Try updating your graphics driver. >> Traceback (most recent call last): >> File "C:\Program Files\ChimeraX 1.0\bin\lib\site-packages\chimerax\ui\graphics.py", line 56, in event >> self._check_opengl() >> File "C:\Program Files\ChimeraX 1.0\bin\lib\site-packages\chimerax\ui\graphics.py", line 76, in _check_opengl >> self._check_for_bad_intel_driver() >> File "C:\Program Files\ChimeraX 1.0\bin\lib\site-packages\chimerax\ui\graphics.py", line 86, in _check_for_bad_intel_driver >> if r.opengl_vendor() == 'Intel': >> File "C:\Program Files\ChimeraX 1.0\bin\lib\site-packages\chimerax\graphics\opengl.py", line 980, in opengl_vendor >> return GL.glGetString(GL.GL_VENDOR).decode('utf-8') >> File "C:\Program Files\ChimeraX 1.0\bin\lib\site-packages\OpenGL\platform\baseplatform.py", line 415, in __call__ >> return self( *args, **named ) >> File "src\errorchecker.pyx", line 58, in OpenGL_accelerate.errorchecker._ErrorChecker.glCheckError >> OpenGL.error.GLError: GLError( >> err = 1282, >> description = b'invalid operation', >> baseOperation = glGetString, >> cArguments = (GL_VENDOR,) >> ) >> Windows fatal exception: access violation >> >> Thread 0x000010d4 (most recent call first): >> File "C:\Program Files\ChimeraX 1.0\bin\lib\ssl.py", line 929 in read >> File "C:\Program Files\ChimeraX 1.0\bin\lib\ssl.py", line 1071 in recv_into >> File "C:\Program Files\ChimeraX 1.0\bin\lib\socket.py", line 589 in readinto >> File "C:\Program Files\ChimeraX 1.0\bin\lib\http\client.py", line 267 in _read_status >> File "C:\Program Files\ChimeraX 1.0\bin\lib\http\client.py", line 306 in begin >> File "C:\Program Files\ChimeraX 1.0\bin\lib\http\client.py", line 1344 in getresponse >> File "C:\Program Files\ChimeraX 1.0\bin\lib\urllib\request.py", line 1322 in do_open >> File "C:\Program Files\ChimeraX 1.0\bin\lib\urllib\request.py", line 1362 in https_open >> File "C:\Program Files\ChimeraX 1.0\bin\lib\urllib\request.py", line 503 in _call_chain >> File "C:\Program Files\ChimeraX 1.0\bin\lib\urllib\request.py", line 543 in _open >> File "C:\Program Files\ChimeraX 1.0\bin\lib\urllib\request.py", line 525 in open >> File "C:\Program Files\ChimeraX 1.0\bin\lib\urllib\request.py", line 222 in urlopen >> File "C:\Program Files\ChimeraX 1.0\bin\lib\site-packages\chimerax\core\toolshed\available.py", line 37 in load >> File "C:\Program Files\ChimeraX 1.0\bin\lib\site-packages\chimerax\core\toolshed\__init__.py", line 444 in reload_available >> File "C:\Program Files\ChimeraX 1.0\bin\lib\threading.py", line 870 in run >> File "C:\Program Files\ChimeraX 1.0\bin\lib\threading.py", line 926 in _bootstrap_inner >> File "C:\Program Files\ChimeraX 1.0\bin\lib\threading.py", line 890 in _bootstrap >> >> Current thread 0x00001c4c (most recent call first): >> File "C:\Program Files\ChimeraX 1.0\bin\lib\site-packages\chimerax\ui\gui.py", line 702 in rapid_access_shown >> File "C:\Program Files\ChimeraX 1.0\bin\lib\site-packages\chimerax\ui\gui.py", line 203 in build >> File "C:\Program Files\ChimeraX 1.0\bin\lib\site-packages\ChimeraX_main.py", line 617 in init >> File "C:\Program Files\ChimeraX 1.0\bin\lib\site-packages\ChimeraX_main.py", line 895 in <module> >> File "C:\Program Files\ChimeraX 1.0\bin\lib\runpy.py", line 85 in _run_code >> File "C:\Program Files\ChimeraX 1.0\bin\lib\runpy.py", line 193 in _run_module_as_main >> >> From: Tom Goddard <goddard(a)sonic.net <mailto:goddard@sonic.net>> >> Sent: Thursday, March 12, 2020 9:37 PM >> To: Lewandowski, Jozef <J.R.Lewandowski(a)warwick.ac.uk <mailto:J.R.Lewandowski@warwick.ac.uk>> >> Cc: chimerax-users(a)cgl.ucsf.edu <mailto:chimerax-users@cgl.ucsf.edu> <chimerax-users(a)cgl.ucsf.edu <mailto:chimerax-users@cgl.ucsf.edu>> >> Subject: Re: [chimerax-users] ChimeraX does not start after installation >> >> Hi Józef, >> >> Try starting ChimeraX from a Windows Command Prompt with the debug option >> >> "c:\Program Files\ChimeraX\bin\ChimeraX-console.exe" --debug >> >> and you will probably get a Python traceback which will give some clue as to what is going wrong. If your graphics driver is not functioning ChimeraX is supposed to show you a window with an error message, but perhaps this has not been tested on Windows. >> >> Tom >> >> >> >>> On Mar 12, 2020, at 3:17 AM, Lewandowski, Jozef <J.R.Lewandowski(a)warwick.ac.uk <mailto:J.R.Lewandowski@warwick.ac.uk>> wrote: >>> >>> Hi, >>> >>> I am trying to get ChimeraX on a Windows 10 installation on a workstation with 4 GPUs (RTX 2080Ti). >>> The program installs just fine but when I start it, it shows the splash screen up to Loading main interface and then quits. I have tried both with the 0.92 release and the daily_build. >>> Any chance you could help with with getting it to work? >>> Browsing archives I learned that this may be down to some incompatibilities with drivers. >>> The onboard graphics is ASPEED Graphics Family with driver version 9.0.10.102 >>> The four Nvidia GeForce RTX2080Ti have driver 26.21.14.4219 installed (I updated to the latest drivers hoping it fixes it - it doesn't). >>> Any ideas or suggestions? >>> >>> Thanks, >>> Józef >>> _______________________________________________ >>> ChimeraX-users mailing list >>> ChimeraX-users(a)cgl.ucsf.edu <mailto:ChimeraX-users@cgl.ucsf.edu> >>> Manage subscription: >>> http://www.rbvi.ucsf.edu/mailman/listinfo/chimerax-users <http://www.rbvi.ucsf.edu/mailman/listinfo/chimerax-users>

1 0

Re: [chimerax-users] ChimeraX does not start after installation
by Tom Goddard 15 Jun '20

15 Jun '20

Hi Józef, The reason ChimeraX does not start on hour Windows computer is given in the middle of this error message: ERROR: ChimeraX requires OpenGL graphics version 3.3. Your computer graphics driver provided version 1.1 Your OpenGL graphics driver is not working. Version 1.1 is from the 1990s and is what Windows gives you when you have no working graphics driver. So the fix will be to install a working graphics driver. When ChimeraX does not get a usable graphics driver it is supposed to still start and present a message explaining this. I am not sure why it crashed in your case. But I see in your error message Windows fatal exception: code 0x80000003 and searching online this says you have misconfigured Windows system files. All the top hits when searching for that error look like scams telling you how to use their special utility to "fix" your system. Be cautious -- I would not suggest running any spacial "cleaner" tools as they are usually malware. Tom > On Jun 14, 2020, at 9:54 AM, Lewandowski, Jozef <J.R.Lewandowski(a)warwick.ac.uk> wrote: > > Hi Tom, > > I finally got to run ChimeraX-console with --debug (did not have access to the machine during lockdown) to see why ChimeraX does not start on my system. I am pasting the output below message. Can you give me any pointers on how to make my ChimeraX installation to work. From a cursory look it seems there is a problem with OpenGL implementation. > Any tips would be welcome. I had latest Nvidia studio drivers, now I updated to the latest Nvidia gaming drivers and the problem with starting ChimeraX persists. > > Thanks, > Józef > > Starting main interface > [15380:7256:0608/122433.144:ERROR:gl_surface_wgl.cc <http://gl_surface_wgl.cc/>(391)] wglCreatePbufferARB not available. > [15380:7256:0608/122433.144:ERROR:gl_surface_qt.cpp(200)] Requested OpenGL implementation is not supported. Implementation: 1 > Windows fatal exception: code 0x80000003 > > Thread 0x000010d4 (most recent call first): > File "C:\Program Files\ChimeraX 1.0\bin\lib\ssl.py", line 1139 in do_handshake > File "C:\Program Files\ChimeraX 1.0\bin\lib\ssl.py", line 870 in _create > File "C:\Program Files\ChimeraX 1.0\bin\lib\ssl.py", line 423 in wrap_socket > File "C:\Program Files\ChimeraX 1.0\bin\lib\http\client.py", line 1422 in connect > File "C:\Program Files\ChimeraX 1.0\bin\lib\http\client.py", line 966 in send > File "C:\Program Files\ChimeraX 1.0\bin\lib\http\client.py", line 1026 in _send_output > File "C:\Program Files\ChimeraX 1.0\bin\lib\http\client.py", line 1247 in endheaders > File "C:\Program Files\ChimeraX 1.0\bin\lib\http\client.py", line 1298 in _send_request > File "C:\Program Files\ChimeraX 1.0\bin\lib\http\client.py", line 1252 in request > File "C:\Program Files\ChimeraX 1.0\bin\lib\urllib\request.py", line 1319 in do_open > File "C:\Program Files\ChimeraX 1.0\bin\lib\urllib\request.py", line 1362 in https_open > File "C:\Program Files\ChimeraX 1.0\bin\lib\urllib\request.py", line 503 in _call_chain > File "C:\Program Files\ChimeraX 1.0\bin\lib\urllib\request.py", line 543 in _open > File "C:\Program Files\ChimeraX 1.0\bin\lib\urllib\request.py", line 525 in open > File "C:\Program Files\ChimeraX 1.0\bin\lib\urllib\request.py", line 222 in urlopen > File "C:\Program Files\ChimeraX 1.0\bin\lib\site-packages\chimerax\core\toolshed\available.py", line 37 in load > File "C:\Program Files\ChimeraX 1.0\bin\lib\site-packages\chimerax\core\toolshed\__init__.py", line 444 in reload_available > File "C:\Program Files\ChimeraX 1.0\bin\lib\threading.py", line 870 in run > File "C:\Program Files\ChimeraX 1.0\bin\lib\threading.py", line 926 in _bootstrap_inner > File "C:\Program Files\ChimeraX 1.0\bin\lib\threading.py", line 890 in _bootstrap > > Thread 0x00001c4c (most recent call first): > File "C:\Program Files\ChimeraX 1.0\bin\lib\site-packages\chimerax\ui\gui.py", line 879 in _populate_menus > File "C:\Program Files\ChimeraX 1.0\bin\lib\site-packages\chimerax\ui\gui.py", line 458 in __init__ > File "C:\Program Files\ChimeraX 1.0\bin\lib\site-packages\chimerax\ui\gui.py", line 196 in build > File "C:\Program Files\ChimeraX 1.0\bin\lib\site-packages\ChimeraX_main.py", line 617 in init > File "C:\Program Files\ChimeraX 1.0\bin\lib\site-packages\ChimeraX_main.py", line 895 in <module> > File "C:\Program Files\ChimeraX 1.0\bin\lib\runpy.py", line 85 in _run_code > File "C:\Program Files\ChimeraX 1.0\bin\lib\runpy.py", line 193 in _run_module_as_main > ERROR: ChimeraX requires OpenGL graphics version 3.3. > Your computer graphics driver provided version 1.1 > Try updating your graphics driver. > Traceback (most recent call last): > File "C:\Program Files\ChimeraX 1.0\bin\lib\site-packages\chimerax\ui\graphics.py", line 56, in event > self._check_opengl() > File "C:\Program Files\ChimeraX 1.0\bin\lib\site-packages\chimerax\ui\graphics.py", line 76, in _check_opengl > self._check_for_bad_intel_driver() > File "C:\Program Files\ChimeraX 1.0\bin\lib\site-packages\chimerax\ui\graphics.py", line 86, in _check_for_bad_intel_driver > if r.opengl_vendor() == 'Intel': > File "C:\Program Files\ChimeraX 1.0\bin\lib\site-packages\chimerax\graphics\opengl.py", line 980, in opengl_vendor > return GL.glGetString(GL.GL_VENDOR).decode('utf-8') > File "C:\Program Files\ChimeraX 1.0\bin\lib\site-packages\OpenGL\platform\baseplatform.py", line 415, in __call__ > return self( *args, **named ) > File "src\errorchecker.pyx", line 58, in OpenGL_accelerate.errorchecker._ErrorChecker.glCheckError > OpenGL.error.GLError: GLError( > err = 1282, > description = b'invalid operation', > baseOperation = glGetString, > cArguments = (GL_VENDOR,) > ) > Windows fatal exception: access violation > > Thread 0x000010d4 (most recent call first): > File "C:\Program Files\ChimeraX 1.0\bin\lib\ssl.py", line 929 in read > File "C:\Program Files\ChimeraX 1.0\bin\lib\ssl.py", line 1071 in recv_into > File "C:\Program Files\ChimeraX 1.0\bin\lib\socket.py", line 589 in readinto > File "C:\Program Files\ChimeraX 1.0\bin\lib\http\client.py", line 267 in _read_status > File "C:\Program Files\ChimeraX 1.0\bin\lib\http\client.py", line 306 in begin > File "C:\Program Files\ChimeraX 1.0\bin\lib\http\client.py", line 1344 in getresponse > File "C:\Program Files\ChimeraX 1.0\bin\lib\urllib\request.py", line 1322 in do_open > File "C:\Program Files\ChimeraX 1.0\bin\lib\urllib\request.py", line 1362 in https_open > File "C:\Program Files\ChimeraX 1.0\bin\lib\urllib\request.py", line 503 in _call_chain > File "C:\Program Files\ChimeraX 1.0\bin\lib\urllib\request.py", line 543 in _open > File "C:\Program Files\ChimeraX 1.0\bin\lib\urllib\request.py", line 525 in open > File "C:\Program Files\ChimeraX 1.0\bin\lib\urllib\request.py", line 222 in urlopen > File "C:\Program Files\ChimeraX 1.0\bin\lib\site-packages\chimerax\core\toolshed\available.py", line 37 in load > File "C:\Program Files\ChimeraX 1.0\bin\lib\site-packages\chimerax\core\toolshed\__init__.py", line 444 in reload_available > File "C:\Program Files\ChimeraX 1.0\bin\lib\threading.py", line 870 in run > File "C:\Program Files\ChimeraX 1.0\bin\lib\threading.py", line 926 in _bootstrap_inner > File "C:\Program Files\ChimeraX 1.0\bin\lib\threading.py", line 890 in _bootstrap > > Current thread 0x00001c4c (most recent call first): > File "C:\Program Files\ChimeraX 1.0\bin\lib\site-packages\chimerax\ui\gui.py", line 702 in rapid_access_shown > File "C:\Program Files\ChimeraX 1.0\bin\lib\site-packages\chimerax\ui\gui.py", line 203 in build > File "C:\Program Files\ChimeraX 1.0\bin\lib\site-packages\ChimeraX_main.py", line 617 in init > File "C:\Program Files\ChimeraX 1.0\bin\lib\site-packages\ChimeraX_main.py", line 895 in <module> > File "C:\Program Files\ChimeraX 1.0\bin\lib\runpy.py", line 85 in _run_code > File "C:\Program Files\ChimeraX 1.0\bin\lib\runpy.py", line 193 in _run_module_as_main > From: Tom Goddard <goddard(a)sonic.net> > Sent: Thursday, March 12, 2020 9:37 PM > To: Lewandowski, Jozef <J.R.Lewandowski(a)warwick.ac.uk> > Cc: chimerax-users(a)cgl.ucsf.edu <chimerax-users(a)cgl.ucsf.edu> > Subject: Re: [chimerax-users] ChimeraX does not start after installation > > Hi Józef, > > Try starting ChimeraX from a Windows Command Prompt with the debug option > > "c:\Program Files\ChimeraX\bin\ChimeraX-console.exe" --debug > > and you will probably get a Python traceback which will give some clue as to what is going wrong. If your graphics driver is not functioning ChimeraX is supposed to show you a window with an error message, but perhaps this has not been tested on Windows. > > Tom > > > >> On Mar 12, 2020, at 3:17 AM, Lewandowski, Jozef <J.R.Lewandowski(a)warwick.ac.uk <mailto:J.R.Lewandowski@warwick.ac.uk>> wrote: >> >> Hi, >> >> I am trying to get ChimeraX on a Windows 10 installation on a workstation with 4 GPUs (RTX 2080Ti). >> The program installs just fine but when I start it, it shows the splash screen up to Loading main interface and then quits. I have tried both with the 0.92 release and the daily_build. >> Any chance you could help with with getting it to work? >> Browsing archives I learned that this may be down to some incompatibilities with drivers. >> The onboard graphics is ASPEED Graphics Family with driver version 9.0.10.102 >> The four Nvidia GeForce RTX2080Ti have driver 26.21.14.4219 installed (I updated to the latest drivers hoping it fixes it - it doesn't). >> Any ideas or suggestions? >> >> Thanks, >> Józef >> _______________________________________________ >> ChimeraX-users mailing list >> ChimeraX-users(a)cgl.ucsf.edu <mailto:ChimeraX-users@cgl.ucsf.edu> >> Manage subscription: >> http://www.rbvi.ucsf.edu/mailman/listinfo/chimerax-users <http://www.rbvi.ucsf.edu/mailman/listinfo/chimerax-users>

1 0

Support
by greene＠chem.ucsb.edu 15 Jun '20

15 Jun '20

Hello, I am using the new ChimeraX, and it is great thus far! One issue I have come across is that if I want to display sidechains that are directly adjacent a connective line links the alpha carbons that I can't seem to get rid of. Tried lots of little workarounds, but can't seem to get it to go away (see attached picture). Is this just a bug I will have to deal with or is there a workaround? Brandon Greene *Assistant Professor * *Department of Chemistry and Biochemistry* *University of California Santa Barbara*

2 1

cut-through session color
by Steve Chou 15 Jun '20

15 Jun '20

Dear ChimeraX developers and users, Is it possible to define the color surface cut-through sessions? Thanks in advance! Steve -- Steve Chou

2 2

Cupy dependency for ChimeraX bundle
by Arthur Ecoffet 09 Jun '20

09 Jun '20

Hi, I am currently trying to develop a bundle for ChimeraX and the methods implemented can both run on GPU (using Cupy with a Cuda dependency) or on CPU. I am wondering how to deal with this "pseudo-dependency" with cupy, since it is not necessary to run the code but it is more computationally efficient. If a Cupy dependency is written in the "bundle_info.xml" file, will it create errors for computers without Nvidia Cuda installed ? Is there any way for users to install supplemental package by hand directly in chimeraX python as it was possible with Chimera ? Or is the only solution to add by hand a dependency line in the xml file ? Thanks, Arthur

3 2

Volume series
by Kotaro TANAKA 08 Jun '20

08 Jun '20

Hi, I'm trying to create a morphing movie of a series of 3D maps. For that purpose, if I understand correctly, I need a volume series (vseries) of those maps, and according to the documentation (https://www.rbvi.ucsf.edu/chimerax/docs/user/trajectories.html#vseries) I should obtain a volume series simply by opening the maps at once in a file opening dialogue. I attached a screen shot of the Models panel after opening my maps, and my question is, are those maps already consisting a volume series? vseries commands fail with 'No volume series specified' I would appreciate your comments, thank you Best regards, Kotaro

4 7

Deleting regions of whole protein
by Anas Hussain 08 Jun '20

08 Jun '20

Hello, I am currently working on a projectpertaining to the Corona Virus. I was wondering if there is anyway I could delete parts of awhole protein using the ChimeraX software. Thank you, Dr. Anas Hussain.

2 1

mesh grid sampling
by Steve Chou 08 Jun '20

08 Jun '20

Dear ChimeraX developers and users, I'm trying to display a map as mesh in ChimeraX, but the grid sampling is too sparse. *volume #1 style mesh level 0.02 step 1 color blue* Is there a way to increase the grid sampling, so that the chicken wires look denser? Thanks in advance! Steve -- Steve Chou

2 2

developing bundles autocompletion
by Daniel Esteban Palma Igor 05 Jun '20

05 Jun '20

Hi, normally I use spyder for writing python code, is there a way to have autocompletion of functions and modules when developing a bundle for ChimeraX? Any other tips for development is well received. Regards, Daniel Palma Igor

2 3

2D and 3D objects
by Jazzar, Rodolphe 04 Jun '20

04 Jun '20

Hi, First of all, this is a great program, and I am barely using it to full extent of its possibilities. I am currently interested in combining a 3D object (a molecule.pdb) and a 2D object/plane/image (as a .png or any other). The idea being that I want to show a slice of an ELF plot, with the 3D molecule embedded through the 2D plot. Good news is that I can import both objects (.pdb and .png). However I face a size issue with the 2D object, which is considerably bigger than the 3D one. Would you know if I can size down a 2D object, or enlarge a 3D one respectively. All in all would you know if chimeraX can generate something like the picture attached by combining a 2D and a 3D object. Thanks for your time, Cheers, Rodolphe [cid:D31DAF51-91B8-4F78-94B3-4C0FCD9C860E] Dr. Rodolphe Jazzar, CNRS Research Associate - (French National Centre for Scientific Research) UCSD-UMI 3555 ORCID : 0000-0002-4156-7826 Office: (858)-534-5315 Mobile: 858-337-2228 University of California, San Diego, 5213 Pacific Hall, Department of Chemistry, 9500 Gilman Dr, # 0343, La Jolla, CA 92093-0343 http://bertrandgroup.ucsd.edu<http://bertrandgroup.ucsd.edu/> https://northamerica.cnrs.fr<https://northamerica.cnrs.fr/> http://www.cnrs.fr/en/cnrs [cid:image001.png@01CFDE12.00855770]

3 2

Re: [chimerax-users] ChimeraX cross links
by Elaine Meng 04 Jun '20

04 Jun '20

> On Jun 4, 2020, at 1:25 AM, Dina Schneidman <duhovka(a)gmail.com> wrote: > > Hi, > We are getting addicted to the ChimeraX graphics, amazing! > I couldn't find how to add cross-links on top of the structure. What would be the best way to do this? > Also, is there a way to color different cross-link types in distinct colors? > Thanks and stay safe! > Dina Hi Dina, Glad you like it, and I certainly hope you and your family are staying safe too! As I understand it there are two ways for atomic structures with crosslinks to be shown in ChimeraX: (1) some integrative modeling structures include such crosslinks. If you download the "cif" from the PDB IHM site <https://pdb-dev.wwpdb.org/> and then change its filename suffix to "ihm" instead, then you can open it in ChimeraX. If the IHM model has crosslinks, they should show up somewhere in the model hierarchy of that data, which you can explore in the Models panel. An example of one with crosslinks is the BBSome: <https://pdb-dev.wwpdb.org/entry.html?PDBDEV_00000018> (2) or if you just have any atomic structure already in ChimeraX and you want to add crosslinks, you can read in pseudobond file (filename.pb), which is just a series of atom-pair specifications in plain text. You can also include color, radius, number of dashes. The file description is the bottom section of this page: <http://rbvi.ucsf.edu/chimerax/docs/user/pseudobonds.html> Also, you can change colors, number of dashes, and radius of any pseudobonds already in the structure or previously added, just using the commands "color" "style" and "size"; see the links in the top section of the pseudobonds page. There is a chimerax mailing list CC-d here for questions (unless they contain private data). I hope this helps, Elaine ----- Elaine C. Meng, Ph.D. UCSF Chimera(X) team Department of Pharmaceutical Chemistry University of California, San Francisco

1 0

Installation of ChimeraX in Centos 7
by Gaya Yadav 01 Jun '20

01 Jun '20

?Dear Sir/Madam, I am trying to install Chimera X in the Centos 7 in my local directory. I installed it by converting it chimerax-rc.cpio?. But I cannot launch it, it was showing error about the openGL. Is that because of the openGL or it is not installed properly? Here is the error: WARNING: QXcbConnection: XCB error: 145 (Unknown), sequence: 178, resource id: 0, major code: 139 (Unknown), minor code: 20 NOTE: available bundle cache has not been initialized yet ERROR: ChimeraX requires OpenGL graphics version 3.3. Your computer graphics driver provided version 1.4 Try updating your graphics driver. WARNING: The X11 connection broke: No error (code 0) XIO: fatal IO error 0 (Success) on X server "localhost:12.0" after 668 requests (668 known processed) with 0 events remaining. ? Thanks Gaya

2 2

Source Code
by Dario Eltzner 29 May '20

29 May '20

Hello, I was interested in reading the ChimeraX source code but found only this site https://www.cgl.ucsf.edu/chimerax/docs/devel/conventions.html which references a git repo that is password protected. Is the source code not freely available? Best Wishes Dario Eltzner

2 2

Re: [chimerax-users] 3D stereo lighting is not the same as mono
by Tom Goddard 27 May '20

27 May '20

Try "camera sbs" and see if shadows look right. If they do look ok, but stereo does not then it will require some debugging with a stereo system that reproduces the problem and I am not able to test that until quarantine is over. Tom > On May 26, 2020, at 10:01 AM, Kenneth Satyshur <kenneth.satyshur(a)wisc.edu> wrote: > > Thanks. I will check out the versions as they come out. Hopefully this can be fixed. I can try a VR and see what is up with the display if anything. > kas > > > Kenneth A. Satyshur, M.S., Ph.D. > Senior Scientist, > Department of Bacteriology: College of Ag and Life Sciences; > Departments of Bio Molecular Chemistry, > Neuroscience, Oncology, and Carbone Cancer Center: > School of Medicine and Public Health; > and the School of Pharmacy > University of Wisconsin-Madison > Madison, Wisconsin, 53706 > 608-215-5207 > From: Tom Goddard <goddard(a)sonic.net> > Sent: Tuesday, May 26, 2020 11:48 AM > To: Kenneth Satyshur <kenneth.satyshur(a)wisc.edu> > Cc: chimerax-users(a)cgl.ucsf.edu <chimerax-users(a)cgl.ucsf.edu> > Subject: Re: [chimerax-users] 3D stereo lighting is not the same as mono > > I made a bug report for this > > https://www.rbvi.ucsf.edu/trac/ChimeraX/ticket/3315 <https://www.rbvi.ucsf.edu/trac/ChimeraX/ticket/3315> > > I am not able to test stereo, don't have a computer that can do it. For me other two eye modes like VR and SBS (side-by-side) have correct shadows. The problem may be a graphics driver bug effecting shadow calculation. Or it might be a bug in ChimeraX in how OpenGL quad-buffering are used. > > Tom > > >> On May 23, 2020, at 4:39 PM, Kenneth Satyshur <kenneth.satyshur(a)wisc.edu <mailto:kenneth.satyshur@wisc.edu>> wrote: >> >> I am using version 1.0 in Centos7 with Nvidia 3D glasses and K4000 video card. I do all my work in 3D stereo. Especially density fitting. I noticed that the lighting is different in mono vs stereo mode. When i go to stereo mode with >> >> camera stereo >> >> the image is in stereo but the "full" lighting is on and the image is very dark with shadows. If I switch to 'simple' it is bright and has weak shadowing. Switching to 'soft' the image is flat black and can only be seen with white background but contains no atoms. I think this is a bug. >> But a Great improvement in rendering of images. >> thanks >> kas >> p.s. old chimera does stereo very well on my system >> Linux kenworkathome 3.10.0-1127.el7.x86_64 #1 SMP Tue Mar 31 23:36:51 UTC 2020 x86_64 x86_64 x86_64 GNU/Linux >> >> >> Kenneth A. Satyshur, M.S., Ph.D. >> Senior Scientist, >> Department of Bacteriology: College of Ag and Life Sciences; >> Departments of Bio Molecular Chemistry, >> Neuroscience, Oncology, and Carbone Cancer Center: >> School of Medicine and Public Health; >> and the School of Pharmacy >> University of Wisconsin-Madison >> Madison, Wisconsin, 53706 >> 608-215-5207 >> _______________________________________________ >> ChimeraX-users mailing list >> ChimeraX-users(a)cgl.ucsf.edu <mailto:ChimeraX-users@cgl.ucsf.edu> >> Manage subscription: >> https://www.rbvi.ucsf.edu/mailman/listinfo/chimerax-users <https://www.rbvi.ucsf.edu/mailman/listinfo/chimerax-users>

2 3

3D stereo lighting is not the same as mono
by Kenneth Satyshur 26 May '20

26 May '20

I am using version 1.0 in Centos7 with Nvidia 3D glasses and K4000 video card. I do all my work in 3D stereo. Especially density fitting. I noticed that the lighting is different in mono vs stereo mode. When i go to stereo mode with camera stereo the image is in stereo but the "full" lighting is on and the image is very dark with shadows. If I switch to 'simple' it is bright and has weak shadowing. Switching to 'soft' the image is flat black and can only be seen with white background but contains no atoms. I think this is a bug. But a Great improvement in rendering of images. thanks kas p.s. old chimera does stereo very well on my system Linux kenworkathome 3.10.0-1127.el7.x86_64 #1 SMP Tue Mar 31 23:36:51 UTC 2020 x86_64 x86_64 x86_64 GNU/Linux Kenneth A. Satyshur, M.S., Ph.D. Senior Scientist, Department of Bacteriology: College of Ag and Life Sciences; Departments of Bio Molecular Chemistry, Neuroscience, Oncology, and Carbone Cancer Center: School of Medicine and Public Health; and the School of Pharmacy University of Wisconsin-Madison Madison, Wisconsin, 53706 608-215-5207

2 1

Recreating views
by Martin Montgomery 22 May '20

22 May '20

Hi, I have a session file that contains everything I need to make figures for a paper. With pymol, I saved the get_view matrix in a text file for each view which meant that with one session file I could easily recreate the views if I needed to go back and tweak a figure. In ChimeraX, the closest way that I found to replicate this was to use named views. Am happy to supply a session file if it helps also happy to be educated if there is a better way of doing this, especially as now the ChimeraX session files can get rather large. Cheers MGM Martin G Montgomery Senior Scientist ATP Synthase Group MRC Mitochondrial Biology Unit University of Cambridge The Keith Peters Building Cambridge Biomedical Campus Hills Road Cambridge Great Britain CB2 0XY www.mrc-mbu.cam.ac.uk <http://www.mrc-mbu.cam.ac.uk/>

5 6

Save/restore scene?
by Oliver Clarke 20 May '20

20 May '20

Hi ChimeraX-ers, Is there currently an equivalent of the "scene" command from Chimera? It was super helpful to be able to quickly switch between different (and often complex) representations of a molecule. I know the view command for saving and restoring orientations, and the "name" command for saving selections, but I can't find an equivalent of scene. I'm guessing it's not yet implemented, but count me as one vote for porting it over after 1.0 is out the door, it was super helpful in Chimera! Cheers Oli

2 1

Feature suggestion - show color code in picker?
by Oliver Clarke 19 May '20

19 May '20

Hi, I love the color editor in ChimeraX, it is much nicer than the one in Chimera and is super useful! One minor suggestion - would it be possible to add a dynamically updated label showing in the editor the current color code? This sometimes shows up in the log but not always, and it is useful to have easily copy-able for use in scripts and aliases. Cheers Oli

3 4

Cartoon smooth loops chimX
by Dominik Hrebík 19 May '20

19 May '20

Hi all! Is there any possibility to smooth loops in cartoon representation in ChimeraX? I can't find it in the user guide. Something similar to pymol's cartoon_smooth_loops,1: https://pymolwiki.org/index.php/Cartoon_smooth_loops Best, Dominik -- ################################## Dominik Hrebik Laboratory of Structural Virology CEITEC, Masaryk University Kamenice 5 / A35 Brno, 625 00, Czech Republic Phone: +420 549 49 7764 <%2B420%20549%2049%207756> ##################################

2 1

Focus in ChimeraX
by Luca Pellegrini 18 May '20

18 May '20

Hi, What is the ChimeraX equivalent to the Focus command in Chimera? I have selected a portion of a structure, and would like to bring it into focus without dragging it into view. Also Focus would automatically set the selection as the pivot point. Best wishes, Luca Luca Pellegrini, PhD Department of Biochemistry University of Cambridge Cambridge CB2 1GA lp212(a)cam.ac.uk

3 2

Turntable rotation
by Scott, Brandon L. 16 May '20

16 May '20

I would like to create an animation where the camera is spun around at a constant azimuthal angle so the object appears to spin on a tabletop. Currently, when I use roll, when it spins to the backside I see underneath the model rather than remaining on top. Any help is greatly appreciated. -Brandon ____________________ Brandon Scott, PhD CZI Imaging Scientist, Research Assistant Professor SDSMT, Nanoscience and Nanoengineering

3 4

Re: [chimerax-users] transition from Chimera
by Tom Goddard 15 May '20

15 May '20

Hi Jerome, Putting that "open instructions,html" in your startup preferences is a nice way to show an HTML interface that could have links that execute commands in ChimeraX. I had not thought of that use. Tom > On May 15, 2020, at 1:37 AM, MUTTERER Jerome (IBMP) <jerome.mutterer(a)ibmp-cnrs.unistra.fr> wrote: > > Hi Tom, > Thank you very much for your answers. > I didn't try the drag and drop emulation approach, but I confirm the "remotecontrol rest" option at startup works nicely. > I added the following 2 lines to the Favorites>Settings...>Startup tab > > remote rest start port xxxxx > open instructions.html > > and it makes it easy to operate. > Thanks a lot! > > Jerome > > > De: "Tom Goddard" <goddard(a)sonic.net> > À: "MUTTERER Jerome, IBMP" <jerome.mutterer(a)ibmp-cnrs.unistra.fr> > Cc: chimerax-users(a)cgl.ucsf.edu > Envoyé: Mardi 12 Mai 2020 20:14:39 > Objet: Re: [chimerax-users] transition from Chimera > > Hi Jerome, > > We don't have the chimerax --send option to open files in an already running ChimeraX, although we plan on adding it. > > I have two ideas for how to do this in current ChimeraX. One is to use the remotecontrol command to tell ChimeraX to accept commands via http. In ChimeraX I enable this with command > > remote rest start port 58123 > > Then http requests can run commands in ChimeraX. The http url can be entered in a web browser or from a script. From a script you could use curl or wget programs, for example, > > curl http://localhost:58123/run?command=open+/Users/goddard/Downloads/ChimeraX/P… <http://localhost:58123/run?command=open+/Users/goddard/Downloads/ChimeraX/P…>.cif > > You could make ChimeraX alway enable http requests by putting the "remote..." command in ChimeraX Settings/Preferences under the Startup tab "Execute these commands at startup". > > The other idea I have is simpler but did not work in my test. ChimeraX accepts files dragged and dropped on the application. On macOS (and probably Linux and Windows) I should be able to run a shell command that says drop this file on ChimeraX. On Mac the shell command looks like > > % open -a /Applications/ChimeraX.app ~/Downloads/ChimeraX/PDB/1a0m.cif > > That worked for starting ChimeraX and showing the first file. But when I run it again to open a different it merely raised ChimeraX and did not open the new file. That is a bug. I've made a bug report for it. I don't know the equivalent commands on Linux and Windows and whether the would work. > > Tom > > > On May 12, 2020, at 1:50 AM, Jerome Mutterer <jerome.mutterer(a)ibmp-cnrs.unistra.fr <mailto:jerome.mutterer@ibmp-cnrs.unistra.fr>> wrote: > > Dear all, > I'm trying to transition from Chimera to ChimeraX, but my workflow relies on passing scripts to an open, with GUI, instance of Chimera using --send > https://www.cgl.ucsf.edu/chimera/docs/UsersGuide/options.html#send <https://www.cgl.ucsf.edu/chimera/docs/UsersGuide/options.html#send> > > I see that this is not described here: > https://www.rbvi.ucsf.edu/chimerax/docs/devel/apps/ChimeraX/ChimeraX.html <https://www.rbvi.ucsf.edu/chimerax/docs/devel/apps/ChimeraX/ChimeraX.html> > > Is that still available somehow in ChimeraX? > Thanks for any input. > Sincerely, > Jerome. > > -- > Jerome Mutterer > CNRS - Institut de biologie moléculaire des plantes > 12, rue du Général Zimmer > 67084 Strasbourg Cedex > www.ibmp.cnrs.fr <http://www.ibmp.cnrs.fr/> > > _______________________________________________ > ChimeraX-users mailing list > ChimeraX-users(a)cgl.ucsf.edu <mailto:ChimeraX-users@cgl.ucsf.edu> > Manage subscription: > https://www.rbvi.ucsf.edu/mailman/listinfo/chimerax-users

1 0

Stuck on one XML-RPC command
by Mungo Carstairs (Staff) 14 May '20

14 May '20

Any XML-RPC fans who can help me with this please? This label command works in the PyMOL command line: label 4zho//A/36/CA 4zho//B/36/CA, "hello world" How do I format an equivalent XML-RPC request? I've tried <methodCall> <methodName>label</methodName> <params> <parameter> <value>4zho//A/36/CA 4zho//B/36/CA</value> </parameter> <parameter> <value>"hello world"</value> </parameter> </params> </methodCall> but get back a fault response XML message with <class 'SyntaxError'>:invalid syntax (<string>, line 1) I have also tried encoding the " as %22, or omitting the quotes, same result. Any ideas please? Thanks, Mungo [University of Dundee shield logo]<http://uod.ac.uk/sig-home> Mungo Carstairs Jalview Computational Scientist The Barton Group Division of Computational Biology School of Life Sciences University of Dundee, Dundee, Scotland, UK www.jalview.org<http://www.jalview.org> www.compbio.dundee.ac.uk<http://www.compbio.dundee.ac.uk> g.m.carstairs(a)dundee.ac.uk<mailto:g.m.carstairs@dundee.ac.uk> [University of Dundee Facebook]<http://uod.ac.uk/sig-fb> [University of Dundee Twitter] <http://uod.ac.uk/sig-tw> [University of Dundee LinkedIn] <http://uod.ac.uk/sig-li> [University of Dundee YouTube] <http://uod.ac.uk/sig-yt> [University of Dundee Instagram] <http://uod.ac.uk/sig-ig> [University of Dundee Snapchat] <http://uod.ac.uk/sig-sc> We're Scottish University of the Year again!<http://uod.ac.uk/sig-strapline> The Times / Sunday Times Good University Guide 2016 and 2017 The University of Dundee is a registered Scottish Charity, No: SC015096

1 0

Stereo and VR support
by Gökhan Tolun 13 May '20

13 May '20

Hi, Would it be possible to make the graphics window undockable, too, Like the other ones? This would allow the use of stereo monitors with SBS and tb support, which does not work currently with menus, etc. surrounding the graphics window. Also, will you implement DTI stereo as in Chimera? By the way, if theres a way of making ISOLDE work in VR, thatd be great! Thanks, Gökhan

3 3

pyqtchart
by Anthony James Schaefer 13 May '20

13 May '20

Hello, I'm interesting in using pyqtchart (https://pypi.org/project/PyQtChart/) as an alternative to matplotlib for some plots in my bundle (I like the default style better, it resizes better - small things like that). If I list pyqtchart as a dependency in my bundle_info.xml like ... <Dependencies> <Dependency name="pyqtchart"/> </Dependencies> ... a new version of PyQt5 gets installed in the directory where bundles get installed. The QChart module from pyqtchart gets installed in this new PyQt5 package. I can't use the QChart module because it's not in the PyQt5 that ChimeraX uses. Is there anything I can do with my bundle to get it to install a usable pyqtchart? Thanks, Tony

2 3

wrong version in download
by Christine Gee 13 May '20

13 May '20

Dear ChimeraX I downloaded what was supposed to be chimeraX 0.5 from your site, and 0.1 instead. I have an older mac with an older OS (10.11.6) and would like the last version that was developed for it. Can you please let me know where I can download 0.5? Also does it work with isolde? Regards Christine Dr Christine Gee Research Specialist Kuriyan Lab HHMI/Molecular and Cell Biology/QB3 527 Stanley Hall MC 3220 University of California, Berkeley Berkeley, CA 94720-3220 Lab Phone: 510 643 0164 Cell: 510 230 7891 Email: christinelgee(a)berkeley.edu <mailto:christinelgee@berkeley.edu>

2 1

Manual segmentation in ChimeraX
by Pattana Jaroenlak (Michael) 13 May '20

13 May '20

Hello, I saw the twitter post from ChimeraX on segmentation of EM serial images ( https://twitter.com/ucsfchimerax/status/1260425173238415360?s=12) It was very beautiful. I have serial section EM images. I am wondering that can I do manual segmentation on ChimeraX? Some cellular features on my images can not be picked up by thresholding or watersheding. Thank you PJ -- *Pattana (Michael) Jaroenlak, PhD* Bhabha & Ekiert Labs Skirball Institute of Biomolecular Medicine New York University School of Medicine *Email: pattana.jaroenlak(a)nyulangone.org <pattana.jaroenlak(a)nyumc.org>, p.jaroenlak(a)gmail.com <p.jaroenlak(a)gmail.com>*

2 1

Renaming chain IDs
by Fahrenkamp, Dirk 12 May '20

12 May '20

Hi ChimeraX team. I am happily using chimeraX along with ISOLDE for modelling. Lately, I am running into issues with complexes having too many chains to be handled by the standard .pdb format which is why I am using .cif now. Is there a smooth way/command to rename chain IDs and change _entity.pdbx_description _struct_asym.entity_id accordingly? Thanks! Kind regards, Dirk -- Dr. rer. nat. Dirk Fahrenkamp UKE Hamburg Zentrum für experimentelle Medizin Institut für Struktur- und Systembiologie/ CSSB Centre for Structural Systems Biology c/o Deutsches Elektronen-Synchrotron DESY Notkestraße 85, Building 15 3.OG D-22607 Hamburg Telefon:+49 (0) 40 8998-87657 Dirk.Fahrenkamp(a)cssb-Hamburg.de www.cssb-hamburg.de

2 1

transition from Chimera
by Jerome Mutterer 12 May '20

12 May '20

Dear all, I'm trying to transition from Chimera to ChimeraX, but my workflow relies on passing scripts to an open, with GUI, instance of Chimera using --send https://www.cgl.ucsf.edu/chimera/docs/UsersGuide/options.html#send I see that this is not described here: https://www.rbvi.ucsf.edu/chimerax/docs/devel/apps/ChimeraX/ChimeraX.html Is that still available somehow in ChimeraX? Thanks for any input. Sincerely, Jerome. -- Jerome Mutterer CNRS - Institut de biologie moléculaire des plantes 12, rue du Général Zimmer 67084 Strasbourg Cedex www.ibmp.cnrs.fr

3 3

Map "Blobs" tool - Generate objects?
by Christophe Leterrier 11 May '20

11 May '20

Hi, I started using ChimeraX for visualization and quantification of 3D microscopy images. The "blob" tool is particularly impressive to semi-automatically segment objects of interest and measure their characteristics. However, I could not find a way to generate an independent object from the picked blobs. This makes the quantification process unreproducible as it is not possible to store the blobs in the session or automatically measure all the picked blobs. Am I wrong in the intent of the tool, or is there a way to do this? Thank you, -- Christophe Leterrier NeuroCyto lab INP CNRS UMR 7051 Aix Marseille University, France

4 5

ChimeraX on Twitter
by Tom Goddard 08 May '20

08 May '20

For ChimeraX news, tips, tricks and special features meet us on Twitter @UCSFChimeraX. https://twitter.com/UCSFChimeraX <https://twitter.com/UCSFChimeraX> Tom, Eric, Elaine, Greg, Conrad, Scooter, Tom -- the UCSF ChimeraX team.

1 0

How to display crystal packing?
by Guillaume Gaullier 08 May '20

08 May '20

Hello, Today I was trying to display a crystal packing from a PDB entry in ChimeraX, but could not find how to do this. I read the documentation for the sym command https://www.cgl.ucsf.edu/chimerax/docs/user/commands/sym.html ; but either I didn’t get it, or this is not the adequate command for what I am trying to do. What I want to do is the equivalent of PyMOL’s "Action / generate / symmetry mates / +/- one unit cell and within… Å", which is different from the biological assembly the sym command can generate from the PDB annotation. When working with crystallographic data, ISOLDE displays molecules related to the working model by crystallographic symmetry, so displaying the crystal packing seems doable in ChimeraX. Or is it one of ISOLDE’s additions? It would be wonderful if someone could help me with this (it is one of the last few things I need on a regular basis, that I still don’t know how to do in ChimeraX). Thank you in advance, Guillaume

3 4

preview ChimeraX 1.0!
by Elaine Meng 07 May '20

07 May '20

The ChimeraX 1.0 (!!) release candidate is now available: <http://www.rbvi.ucsf.edu/chimerax/download.html> Please, please try it out and report any issues that you find, as we plan to make the production release by the end of the month. To report issues, use the ChimeraX menu: Help... Report a Bug <http://www.rbvi.ucsf.edu/chimerax/docs/contact.html> For what's new, see the Change Log: <https://www.rbvi.ucsf.edu/trac/ChimeraX/wiki/ChangeLog> Thanks! Elaine ----- Elaine C. Meng, Ph.D. UCSF Chimera(X) team Department of Pharmaceutical Chemistry University of California, San Francisco

1 0

Problems with making movie in chimerax
by Nandish Kumar Khanra 07 May '20

07 May '20

Hello all, I want to make a movie of a multi-domain protein between two functional states using Chimerax. One domain undergoes drastic conformational change while there is virtually no structural change in another domain. I did the following steps to make the movie. * Aligned two models using matchmaker, mm #1 to #2 pair ss ss false * make morph morph #1,2 frames 100 play false cartesian true * make movie movie record size 1000,1000 coordset #3 wait 100 movie encode output ~/Desktop/movie1.mp4 quality higher framerate 25 roundTrip true The stationary domain of two functional states aligned perfectly after structural alignment, but I do see motions in that domain in the movie. Am I doing anything wrong? Is there a way to overcome this? Thanks, Nandish

4 7

Script to color zone a map according to the underlying model
by Caroline Stone 07 May '20

07 May '20

Dear All, As an exercise in scripting, I am trying to write a script to imitate the appearance a published figure (from Toropova et al 2017). I would like to display a semi-transparent map which has been color zoned to match the underlying model in surface view. ChimeraX does everything in the script apart from the last two commands, in which I color zone the map, and then make it transparent. I don't get any errors in the log to give me a clue what to change. If I omit these last two commands from the script and then make them manually from the command line after the script is finished, it works. Is there something I can change that would allow me to include the final two commands in the script? Any pointers would be much appreciated. # ChimeraX script to imitate dynein 2 tail Toropova et al 2017 figure style # Adds custom colours to the ChimeraX session # Open model and set camera view and model rotation open 6RLB windowsize 775 775 view matrix camera -0.30533,0.56038,0.76991,623.53,0.82837,-0.24247,0.50499,467.83,0.46967,0.79195,-0.39016,-7.3434 models #1,1,0,0,0,0,1,0,0,0,0,1,0 # Work with model representation surface #1 set bgColor white lighting soft graphics silhouettes true # Define custom colours color name midblue #6b80b5 color name midgreen #a0c497 color name midyellow #f9ef87 color name midtomato #f97054 color name midmagenta #a4449b # Recolour model using custom colours defined above select #1/A; color sel midblue select #1/B; color sel skyblue select #1/C; color sel midtomato select #1/D; color sel midmagenta select #1/E/F; color sel midgreen select #1/G/H; color sel lightpink select #1/I-N; color sel midyellow select clear # Open map and modify color and transparency open emdb:4918 volume #2 step 1 volume #2 level 0.0172 surface dust #2 size 10 color zone #2 near #1 distance 15 volume #2 transparency 0.75 Best wishes, Caroline

3 3

Silhouettes cause fill
by Daniel Asarnow 06 May '20

06 May '20

Hi, Is there any way to avoid this effect where silhouettes lead to an apparent flood fill? The helix in the upper left of this clip shows what I mean: [image: image.png] I was able to work around it a bit by making the silhouettes thinner than I'd like, and aggressively supersampling. It seems severe with any silhouette width greater than 1. Thanks and best, -da

4 9

Re: [chimerax-users] Chimera X -showing electrostatic potential
by Elaine Meng 06 May '20

06 May '20

Dear Yi Shi, The structure is nice work, and worth showing off! We are fine so far... I hope you are well too. To color a surface by electrostatic potential in ChimeraX, currently you need to use a separate program to generate the electrostatic potential map, for example the APBS web server or the DelPhi web server mentioned/linked to the Chimera tutorial here: <http://www.rbvi.ucsf.edu/chimera/docs/UsersGuide/tutorials/surfprop.html#es…> After you generate the map (e.g. a .dx file, .phi file, or .cube file) <http://rbvi.ucsf.edu/chimerax/docs/user/commands/open.html#volume> ... then you can open it in ChimeraX and use it for coloring the protein molecular surface with the ChimeraX "color electrostatic" command: <http://rbvi.ucsf.edu/chimerax/docs/user/commands/color.html#map> If you open a .cube file it will automatically show as isosurfaces. However, you can hide the isosurfaces such as by clicking the "eye" icon in the Volume Viewer panel, and then carry on with using the coloring command as mentioned above. Of course, you need to open the protein structure and then display the protein's molecular surface first, e.g. with the "surface" command, Actions menu, or Molecule Display icon. <http://rbvi.ucsf.edu/chimerax/docs/user/commands/surface.html> I hope this helps, Elaine ----- Elaine C. Meng, Ph.D. UCSF Chimera(X) team Department of Pharmaceutical Chemistry University of California, San Francisco > On May 5, 2020, at 7:14 PM, Yi Shi <yi.shi(a)pitt.edu> wrote: > > Dear Elaine, > > Hope this finds you, your family and colleagues safe and well. > > We have a question about Chimera X software that you and your colleagues developed. Do you know how to show the electrostatic potential using Chimera X? Do we need some external software to do this? > > BTW, the software that you developed was amazing that we really enjoy it. And thanks a million for using our Nup84 hybrid structure for the cover of your paper in Protein Science. Absolutely beautiful work! > > Thanks in advance. > Yi > > Yi Shi Ph.D. > Assistant Professor > Department of Cell Biology > Program for Integrative Systems Biology > Pitt/ CMU Program in Computational Biology > University of Pittsburgh School of Medicine > BST3 9049 > 3500 5th Avenue > Pittsburgh PA 15213 > 412-383-3242 (office) > 412-383-3243 (lab) > www.shi-lab.org

2 3

Scroll threshold step size
by Daniel Asarnow 04 May '20

04 May '20

Hi, Is it possible to adjust the step size when using alt + scrollwheel to change the contour level? I'd like to make it coarser for RSI reasons. Thanks, -da

3 6

ubuntu 20.04
by Hua tiger 03 May '20

03 May '20

Please create a download and install package for ubuntu 20.04 Thank you very much. John

2 3

Chimera-Animation equivalent utility/command
by Ray Y.-R. Wang 01 May '20

01 May '20

Dear all, I have been searching for the equivalent function in ChimeraX for the Animation functionality (under Tools/Utilities) in Chimera, where we can save many checkpoints as "scenes" in one Chimera session. I am wondering whether there's a command-line equivalent thing in ChimeraX I can adapt. Thanks so much! Best, Ray

2 5

Missing segments
by Daniel Asarnow 01 May '20

01 May '20

Hi all, When I save a CIF from ChimeraX, the missing segment pseudobonds are replaced by real (super unphysical) bonds. Can I do something about it, or is this a bug? Thanks and best, -da

5 7

morph movie with secondary structure and dssp
by Joel Meyerson 30 Apr '20

30 Apr '20

Hi, I am making a morph between two PDB models representing two states of the same protein, and the overall secondary structure does not change much between the models. However, there is a region where the secondary structure does change. I would like to capture the secondary structure change in the morph and have a couple questions. 1. It seems the morph uses the secondary structure from PDB #1. Is there a way to use the two different secondary structure headers from the two PDBs to define the secondary structure endpoints on the morph? 2. If the above is not possible, is there a way to restrict DSSP to update only the region of interest (i.e. a residue range), and not change secondary structure throughout the molecule? Thanks, Joel

2 2

addh and phenix
by Daniel Asarnow 24 Apr '20

24 Apr '20

Hi, Seems like with NAG glycans the addh result is incompatible with phenix real space refinement. It's easy enough to fix by deleting HD2 - the offending hydrogen - manually. I was wondering if anyone had an opinion about this, before I report a phenix bug. Error looks like: Number of atoms with unknown nonbonded energy type symbols: 5 "ATOM 2629 HD2 ASN A 362 .*. H " (4 more similar lines). Best, -da

3 2

How to hide dashed lines?
by Steve Chou 24 Apr '20

24 Apr '20

Dear ChimeraX developers and users, I see a dashed line between an ion and a side chain when I display the side chain. Is there a way to hide the dashed line, either in command line or GUI? How to select all the atoms in residues (e.g., /A:10-100) except n, c, and o atoms? Many thanks, Steve -- Steve Chou

2 1

displaying ribbon and tube simultaneously
by Joel Meyerson 23 Apr '20

23 Apr '20

Hi, I would like to display a model as a ribbon, but then specify a single helix to show as a tube. So far I’ve only been able to show the model either entirely as a ribbon, or entirely as tubes. Is there syntax I can use to blend the two helix styles? Thanks, Joel

3 5

Molecular Docking problem
by Estela Fernandes e Silva 23 Apr '20

23 Apr '20

Dears, Good night! I'm starting to use SwissDock to investigate new drugs. I'm having trouble viewing “the best result” through Chimera for Web (the browser cannot be configured) In the option “Download your predictions file” I can open all the ligands through ChimeraX (my computer's desktop) at the same time. But I would like to see only one ligand at a time. Would it be possible? Best regards Estela

2 2

deleting sidechain in ChimeraX
by Joel Meyerson 22 Apr '20

22 Apr '20

Hi, What is the command or sequence of commands which can be used to delete the sidechain on an amino acid or range of amino acids? I reviewed the ChimeraX atom spec page but could not find a way to do this. Thanks, Joel

2 2

Problem with showing 4 Fe-4S in pdb with chimerax
by Meinan Lyu 22 Apr '20

22 Apr '20

Dear chimerax-users(a)cgl.ucsf.edu, There is a 4 Fe-S in my structure, it shows a little bit funny when I open it with chimerax. It should only have links between Fe and S, but between 2Fe shows a link line two. Do you know how to show it normally like in pymol, or remove the links between 2Fe? I really want to draw some figures in chimerax. The attached are 4 Fe-S shown in chimrax,also shown in pymol. PDB id 2WDQ is also attached, which 4 Fe-S is in /B,F,J:303. Thanks very much. Be safe and Best, Meinan Postdoc from CWRU

2 2

shape tool in ChimeraX
by Joel Meyerson 20 Apr '20

20 Apr '20

Hi, Chimera has a “shape” command that I find quite useful. Does ChimeraX have this feature? I could not find it in the online documentation. Thanks, Joel

3 4

Re: [chimerax-users] [EXT] Re: passing arguments to python scripts with command runscript
by Philipp Milkereit 15 Apr '20

15 Apr '20

Hi Eric, thanks for your fast help, works now as expected! Philipp Von: Eric Pettersen <pett(a)cgl.ucsf.edu> Gesendet: Mittwoch, 15. April 2020 22:19 An: Philipp Milkereit <philipp.milkereit(a)vkl.uni-regensburg.de> Cc: ChimeraX Users Help <chimerax-users(a)cgl.ucsf.edu> Betreff: [EXT] Re: [chimerax-users] passing arguments to python scripts with command runscript Hi Philipp, In ChimeraX, the arguments will be in sys.argv — namely sys.argv[1:] since sys.argv[0] will be the name of your script file. --Eric Eric Pettersen UCSF Computer Graphics Lab On Apr 15, 2020, at 12:47 PM, Philipp Milkereit <philipp.milkereit(a)vkl.uni-regensburg.de <mailto:philipp.milkereit@vkl.uni-regensburg.de> > wrote: Dear all, in Chimera 1 it was possible to pass arguments with runscript to python scripts which could be read out there by arguments[index]. In ChimeraX I am not anymore able to read passed values using arguments[index] in python scripts called by runscript. Was that feature dismissed or was there a change in the naming? Thanks for your help, Philipp _______________________________________________ ChimeraX-users mailing list <mailto:ChimeraX-users@cgl.ucsf.edu> ChimeraX-users(a)cgl.ucsf.edu Manage subscription: <http://www.rbvi.ucsf.edu/mailman/listinfo/chimerax-users> http://www.rbvi.ucsf.edu/mailman/listinfo/chimerax-users

1 0

passing arguments to python scripts with command runscript
by Philipp Milkereit 15 Apr '20

15 Apr '20

Dear all, in Chimera 1 it was possible to pass arguments with runscript to python scripts which could be read out there by arguments[index]. In ChimeraX I am not anymore able to read passed values using arguments[index] in python scripts called by runscript. Was that feature dismissed or was there a change in the naming? Thanks for your help, Philipp

2 1

syntax on marker and marker link placement
by Joel Meyerson 12 Apr '20

12 Apr '20

Hi, I have a question about marker and marker link syntax. Suppose model #1 has chains A and B, and that chains A and B form a homodimer where each subunit has the same residue numbering. I would like to place a marker at the midpoint between alpha-carbons of position 10 on A and 10 on B. In turn, I'd like another marker at the midpoint between position 20 on each of the two subunits. I would then like to draw a linker between the two markers. I would expect the following syntax to work, but I get an error. marker #2 #1/a,b:10@CA color yellow radius 1 marker #2 #1/a,b:20@CA color yellow radius 1 marker link #2:1,2 color yellow radius 0.5 Gives the error: Missing or invalid "position" argument: Expected 3 floats or object specifier Any suggestions on how to fix the syntax, or is there an alternative approach? Thanks, Joel

2 4

Move Z plane backside
by Aritz Roa Eguiara 09 Apr '20

09 Apr '20

Dear ChimeraX team, I would like to ask if there is any command to move the Z plane but not the front, but the back one, while recording a movie. I am familiar with clipping, however when recording a movie it directly appears, is there any way to do the same move z but for the far plane? Thank you in advance and happy Easter, Aritz

2 1

How to do repetitive task using Python or command line in ChimeraX?
by 이서원 09 Apr '20

09 Apr '20

Hello, I think I'm good at dealing with the previous Chimera command line, and I'm learning Python coding and ChimeraX little by little. In Chimera, I was able to apply the Chimera command to a Python script using runCommand. So, I wrote some python scripts for Chimera, such as automatically coloring or cropping maps and/or models based on the target specification list in plain text. However, I think there's no python modules like runCommand, and I don't know how to repetitively input specifications by .cxc files. (Do I have to make as many .cxc files as many as the number of the variables?) Also I tried to understand the ChimeraX developer tutorial, but I failed to import color functions on chimeraX Python Shell. (I didn't understand how to import experimental API) Is there any fancy way to create a .cxc file that executes by sequentially inputting variables in the list? Or, How to import python modules such as color functions? (https://www.cgl.ucsf.edu/chimerax/docs/devel/core/commands/user_commands.ht…) Best regards, Seowon ______________________________________________________________________________________ 이 서 원 | Selcia Seowon Lee selcia20(a)snu.ac.kr Laboratory of Molecular Imaging , Ph.D. Candidate Department of Biological Sciences, College of Natural Sciences Seoul National University, Gwanak-gu Gwanak-ro 1, Bldg105 Rm109, Seoul 08826, Korea

3 3

How to do repetitive task using Python or command line in ChimeraX?
by 이서원 08 Apr '20

08 Apr '20

Hello, I think I'm good at dealing with the previous Chimera command line, and I'm learning Python coding and ChimeraX little by little. In Chimera, I was able to apply the Chimera command to a Python script using runCommand. So, I wrote some python scripts for Chimera, such as automatically coloring or cropping maps and/or models based on the target specification list in plain text. However, I think there's no python modules like runCommand, and I don't know how to repetitively input specifications by .cxc files. (Do I have to make as many .cxc files as there are variables?) Also I tried to understand the ChimeraX developer tutorial, but I failed to import color functions on chimeraX Python Shell. (Experimental API Is there any fancy way to create a .cxc file that executes by sequentially inputting variables in the list? Or, How to import python modules such as color functions? (https://www.cgl.ucsf.edu/chimerax/docs/devel/core/commands/user_commands.ht…) Best regards, Seowon ______________________________________________________________________________________ 이 서 원 | Selcia Seowon Lee selcia20(a)snu.ac.kr Laboratory of Molecular Imaging , Ph.D. Candidate Department of Biological Sciences, College of Natural Sciences Seoul National University, Gwanak-gu Gwanak-ro 1, Bldg105 Rm109, Seoul 08826, Korea

1 0

silhouette scaling and image dimension
by Joel Meyerson 08 Apr '20

08 Apr '20

Hi, I noticed that when I save images in ChimeraX with silhouettes on, the apparent width of the silhouette in the output image seems to scale inversely with the image dimensions. For example, these three commands give slightly different silhouette thicknesses. Images attached. save ~/Desktop/image1.png width 500 height 500 save ~/Desktop/image2.png width 1000 height 1000 save ~/Desktop/image3.png width 2000 height 2000 Is there a way to have a fixed silhouette thickness in output images? I'd also be interested to know why this happens. Thanks, Joel

2 2

Making New Bonds between Protein & Ligand
by Gupta, Arun 08 Apr '20

08 Apr '20

Hi I followed similar " marker link " trick proposed by Tom for making new bonds between a selection of Serine residue of protein molecule with hydroxy group functionality of ligand molecule typing the below mentioned command in ChimeraX command line . marker link #1:54@OG #2:PNS@HOP1@SG radius 0.2 However, I am repeatedly getting following error. " TypeError: Cannot bond atoms in different molecules " Can you plz suggest the correct command or alternative way for making new bond between Protein & ligand molecules. Thanks Arun

2 1

Making new bonds
by Mutum YAikhombA 07 Apr '20

07 Apr '20

Hi I was trying to make new disulphide bonds between a pair of cysteine residues (say residue numbers 142 and 157) using ChimeraX. The standard Chimera command - 'bond' doesn’t work in ChimeraX. I have gone through the structure editing tool and couldn’t find an equivalent tool. I found some command-line tools in this page (new-bond), but this seems to be not so straightforward to use - https://www.rbvi.ucsf.edu/chimerax/docs/devel/bundles/atomic/src/atomic.htm… <https://www.rbvi.ucsf.edu/chimerax/docs/devel/bundles/atomic/src/atomic.htm…>. Could you please help? Thanks Yaikhomba

5 4

cartoon highlight color?
by Joel Meyerson 07 Apr '20

07 Apr '20

Hi, Is there a way to customize the highlight color of helices and strands? For example, here is how it appears in Pymol. https://pymolwiki.org/index.php/Cartoon_highlight_color Thanks, Joel

2 2

cxc script does not execute 'surface dust' command
by Joel Meyerson 07 Apr '20

07 Apr '20

Hi, I am observing inconsistent behavior in the ‘surface dust’ command. When I launch ChimeraX and execute the following commands one-by-one at the command line everything works as expected. However, if I place the commands in a cxc script, then double click the script ChimeraX launches and the script executes, but the ‘surface dust’ command does not hide the dust. In addition, within that same session I can then enter the ‘surface dust’ command manually and it works as expected. I’m running ChimeraX Daily 0.93 (2020-04-04) on Mac OS 10.15.1. Do you know why the command is not working inside a script? close all open map.mrc turn x 90 volume erase #1 center 175,160,314 radius 100 outside true surface dust #2 size 40 Thanks for the help. Joel

2 3

Command "mlp"
by Cosmin Stefan Butnarasu 06 Apr '20

06 Apr '20

Hello, Hope to find you doing well. I am a PhD student in Pharmaceutical and Biomolecular Sciences and I am writing this email because I would like to better understand the mlp command. First of all, I have to say that I am a very novice on ChimeraX, I discovered this software basically few days ago, so I will write concepts that maybe are not properly correct. I would like to calculate the surface hydrophobicity of a protein. I saw that the mlp command graphically displays the molecular lipophilicity potential, which I suppose is somehow close to the surface hydrophobicity. However, when mlp command is compute, in the Log panel are shown three values, a minimum, a mean and a maximum, which I have not completely understood what they are for (see the picture attached). I searched on ChimeraX manual and I found that the SES surface could stand for “solvent-excluded surface” but I’am not sure about this. If so, could the mean SES value be a measure of the surface hydrophobicity of the protein? If not, can you suggest me a method to obtain not only a graphical display but also a value of the overall molecular lipophilicity potential? Thank you in advance! Cosmin Stefan Butnarasu ********************************************************* Cosmin Stefan Butnarasu, PhD Student Department of Molecular Biotechnology and Health Sciences University of Torino Via Gioacchino Quarello 15, 10135 email: cosminstefan.butnarasu(a)unito.it *********************************************************

2 3

Questions about ChimeraX
by Yuhua Fang 06 Apr '20

06 Apr '20

Hi Recently I transferred to ChimeraX from the old version. I found: 1. Some SMILE strings copied directly from ChemDraw cannot be recognized by ChimeraX, such as O=C1NC2=C(/C1=C3NC4=CC=CC=C4C/3=C\O)C=CC(Br)=C2 2. Correct me if I am wrong but ChimeraX seems not able to do molecule docking/ligand minimization like the old version, right? Thank you Joshua Sent from Mail<https://go.microsoft.com/fwlink/?LinkId=550986> for Windows 10

3 2

Show map only around certain selection
by Karim Rafie 02 Apr '20

02 Apr '20

Dear all, I was wondering how to show part of a map only surrounding certain residues, i.e. I have coordinates for a multiple-chain PDB but I only want to show the electron density surrounding one chain. Any help would be greatly appreciated. Best, Karim ############################################## Karim Rafie; PhD, AMRSC Postdoctoral Research Fellow Carlson Lab Department of Medical Biochemistry and Biophysics Umeå University Umeå / Sweden

2 2

ChimeraX equivalent to "Chimera web data"?
by Ben Webb 01 Apr '20

01 Apr '20

We have a number of web services and tools that generate web data (*.chimerax) files for legacy Chimera. (Typically they load in a PDB file and an alignment and apply some sort of custom view.) What would the equivalent be for ChimeraX? Ben -- ben(a)salilab.org https://salilab.org/~ben/ "It is a capital mistake to theorize before one has data." - Sir Arthur Conan Doyle

4 9

bundle_info.xml API changes
by Eric Pettersen 01 Apr '20

01 Apr '20

Any non-developers feel free to skip this message. Even for developers, unless you are writing a toolshed bundle that uses the DataFormat, Open, Save, and/or Fetch tags in the bundle’s bundle_info.xml file, you could skip this message. For the two of you that are left, in anticipation of the the ChimeraX 1.0 release sometime this year we are changing some APIs we are unhappy with. Namely, the tags in the in bundle_info.xml that I mentioned in the previous paragraph. As they stand, they are not easily extensible and it is not obvious without looking at the documentation what the various fields do. On top of that, it is difficult to take the information in those tags and present interfaces for options in ChimeraX’s Open/Save file dialogs. Also, there is nothing preventing keywords added to the open command by one bundle from conflicting with keywords added by another bundle. We will be migrating those tags to use bundle_info’s Manager/Provider architecture (described here <https://www.cgl.ucsf.edu/chimerax/docs/devel/tutorials/bundle_info.html>). Instead of fixed fields, you have keyword/value pairs, which is slightly more self-documenting. Also, a manager can ask a provider for various things, so in one case the manager can provide a partially processed “open” command along with the “rest of line” for the provider to handle its options, if any, and actually open the file, whereas in another the manager can ask for a widget containing options to show in an open or save dialog. In brief, the change allows us to solve some issues that looked pretty intractable with the old scheme. The exact details of the managers and providers supporting these functions are not detailed in that link (just the generic mechanism), but details will be added as implementations are completed. For convenience, there will some period of time when both the old scheme and new scheme will both work, but we anticipate dropping the old scheme before the 1.0 release. —Eric Eric Pettersen UCSF Computer Graphics Lab

2 4

Keep coordinates and radii of atoms
by Aritz Roa Eguiara 31 Mar '20

31 Mar '20

Dear ChimeraX Team, I am trying to represent a channels in ChimeraX. The output of Mole 2.5 is a .py for Chimera and I am trying to manually transfer to ChimeraX. Is there any easy way to do that? I would need that the coordinates and the radii of each atom is respected, but if I save it from Chimera in PDB the radii is not saved and saving the different atoms manually and then adding a script to give the the proper radius is extremely time consuming. Any suggestion? All the best, Aritz

2 1

upgrading ChimeraX Toolshed
by Greg Couch 30 Mar '20

30 Mar '20

We're modernizing the ChimeraX Toolshed code base. There is a chance that it won't be accessible for day or two. And there's a chance it will be fixed in the next hour. :-) -- Greg

1 0

volume onesmask usage question
by Alexis Rohou 30 Mar '20

30 Mar '20

Hi there, I was trying to use "volume onesmask" to go quickly from a dusted surface of a low-pass-filtered volume to a mask volume with the same dimensions, spacing, etc. as the input map. I thought "fullmap" might be a way to achieve this (the doc says "The remaining options are the same as described for volume mask"), but I don't think that option actually works with "volume onesmask": volume onesmask #3 fullmap true *Expected a keyword* Is there a "onesmask"-like operation or set of options that creates an output volume that's on the same grid as the input volume? Thanks, Alexis

3 7

ToolInstance context menu displaying help
by Anthony James Schaefer 27 Mar '20

27 Mar '20

Hello, can tools' "Help" option in the context menu be changed to use `ToolInstance.display_help` instead of running the `help` command? I'd like to keep most of my documentation on GitHub. The `help` command cannot open URLs, so I thought I'd overwrite my tools' `display_help` methods to use `open` instead. However, I discovered this method isn't used anywhere. I've tried changing `_show_context_menu` in chimerax.ui.gui (around line 2087) to `help_action.triggered.connect(ti.display_help)`. It seems to behave the same for all built-in tools. I understand there might be reasons to not do this (e.g. users might not be able to connect to the internet). I'd like to keep stuff on GitHub because I can make a page on a GitHub wiki page faster than an HTML doc. Regardless of how tools' help pages get shown, I'd like to have examples of what my bundle can do on the GitHub wiki. To that end, my GitHub wiki could serve a dual purpose: a showcase and documentation. Best, Tony

3 4

Coloring of atomic model surfaces
by Rasmus Kock Flygaard 27 Mar '20

27 Mar '20

Dear ChimeraX developers, I have a question regarding coloring of a surface representation of an atomic model. I open the pdb file and turn on surface representation with the command, surface #1 resolution 6 This works just fine. Then I color the surface by command, color #1 skyblue This also works fine. And then I want to color the surface of only a range of residues using the command, color #1:50-86 indigo target s But nothing happens. The reply log says that 1 surface was colored but no color changes is seen in the surface representation. Am I missing something in the color command for surfaces?? Any help is appreciated! Best, Rasmus Kock Flygaard

2 1

addAtom
by Aritz Roa Eguiara 26 Mar '20

26 Mar '20

Dear ChimeraX team, Maybe it is a silly question but I have been trying to add atoms on ChimeraX but I have not found the way, is there any possibility? I need to plot a channel on my protein but I do not manage to do it without that. Thank you in advance. Best wishes, Aritz

2 2

Loss of image quality
by Lucas Tafur 26 Mar '20

26 Mar '20

Hi, I hope everything is going well considering the circumstances. I've been enjoying ChimeraX but have now encountered an annoying issue. Without any apparent reason, the quality of my rendered images becomes very bad, eventhough I'm using the same command and sampling. I've been saving using the following command: save C:\Users\XXXXX.png transparentBackground true supersample 3 It always worked fine until this week (actually, two days ago the quality was still good). Suddenly it started getting bad. I'm using version 0.93. Any help would be appreciated. Best, Lucas

2 1

NMR CSPs
by Bohg, Claudia 25 Mar '20

25 Mar '20

Hey, is it somehow possible to use this attribute in Chimera X? http://www.cgl.ucsf.edu/chimera/data/nmrcolor-nov2017/nmrcolor.html Best, Claudia

2 3

ChimeraX VTK Export
by Angelos Angelopoulos 19 Mar '20

19 Mar '20

Hello, It would be absolutely great if ChimeraX supported exporting to a VTK file like Chimera did. Are there any plans to port the VTK export functionality from Chimera to ChimeraX? If not, please consider doing it. Thank you very much. Sincerely, Angelos Angelopoulos

2 2

Re: [chimerax-users] Making movies and fitting structures into cryoEM
by Elaine Meng 13 Mar '20

13 Mar '20

Dear Madhan, My previous message already explained how you would move only one model in ChimeraX (you have to select part of it with Ctrl-click and then use the mouse mode "translate selected models" etc.). For example clicking the "translate selected models" icon in the Right Mouse toolbar assigns this mode to the right mouse button (= trackpad + Alt on Windows, trackpad + command key on Mac). See here for which Right Mouse icons go with which functions: <http://rbvi.ucsf.edu/chimerax/docs/user/tools/mousemodes.html> It sounds like even when you are moving everything together, you don't know how to translate models (up, down, left right) in either program. In Chimera, the default for translation is middle mouse button, or touchpad + option key on Mac (the key may be different on WIndows, just try the ones to the left of the space bar to see which one works). See the Mouse Preferences (menu Favorites... Preferences, change to category: Mouse) for button assignments: <http://www.rbvi.ucsf.edu/chimera/docs/UsersGuide/preferences.html#Mouse> See also "using touchpad or 1-button or 2-button mouse" <http://www.rbvi.ucsf.edu/chimera/docs/UsersGuide/mouse.html#2button> In ChimeraX, use command "mousemode" if you want to change assignments. The "mousemode" manpage linked below also shows a table of the default assignments, e.g. translation is middle mouse button, or Mac trackpad + Alt (or 3-finger drag if multitouch enabled), or Windows trackpad + Ctrl-Alt. <http://rbvi.ucsf.edu/chimerax/docs/user/commands/ui.html#mousemode> I hope this helps, Elaine > On Mar 13, 2020, at 11:28 AM, Tirumalai, Madhan R <mrtirum2(a)Central.UH.EDU> wrote: > > Dear Elaine > > Thank you again. > > In Chimera - am able to lock one model by unchecking the "A" box in the Model Panel - in the particular example am working with, its the Cryo-EM density map - the other model is the atomic model from the crystal structure (PDB file) - am not able to move the atomic model into the Cryo-EM density model. When I use the mouse, all am able to do is rotate the second (atomic) model at the same place - am not able to move it from its location on the screen. > > In ChimeraX - its the same problem and since it does not have the model planel, both models are moving at the same time - the commands are a bit confusing as well > > > > From: Elaine Meng <meng(a)cgl.ucsf.edu> > Sent: Friday, March 13, 2020 10:07 AM > To: Tirumalai, Madhan R <mrtirum2(a)Central.UH.EDU> > Cc: ChimeraX Users Help <chimerax-users(a)cgl.ucsf.edu> > Subject: Re: [chimerax-users] Making movies and fitting structures into cryoEM > > Dear Madhan, > I don't understand "not able to lock" in ChimeraX or "not able to move" in Chimera. > > In Chimera, you can control whether each model is hand-movable or not by checking/unchecking the "A" (activated) boxes in the Model Panel, as discussed here: > <http://www.rbvi.ucsf.edu/chimera/docs/UsersGuide/mouse.html#activedef> > > Show the Model Panel from the Chimera Favorites menu. > > By hand you can then move the atomic model to roughly the correct place in the map before optimizing the fit with Fit in Map. > > The ChimeraX tool Fit in Map is basically the same as the Chimera tool. However, in ChimeraX, the way to move just one model is to select some part of it (Ctrl-click) and then use the mouse mode "move selected models" as discussed in this earlier post: > <http://www.rbvi.ucsf.edu/pipermail/chimerax-users/2017-November/000157.html> > > Also if you additionally press Shift, that mode switches between rotate and translate. > <http://rbvi.ucsf.edu/chimerax/docs/user/tools/mousemodes.html> > > I hope this helps, > Elaine > ----- > Elaine C. Meng, Ph.D. > UCSF Chimera(X) team > Department of Pharmaceutical Chemistry > University of California, San Francisco > > > > On Mar 12, 2020, at 6:23 PM, Tirumalai, Madhan R <mrtirum2(a)Central.UH.EDU> wrote: > > > > Dear Elaine > > > > Thank you - all those tips were useful. > > > > With ChimeraX, am not able to lock the Cryo-EM density map and then use the crystal structure to fit into it. > > > > Whereas Chimera allows me to do so - however am not able to move the crystal structure to superimpose on the CryoEM density to do the 'Fit in Map' > > > > is it something am not doing right? I follow these instructions - https://www.cgl.ucsf.edu/chimera/data/tutorials/volumetour/volumetour.html#… > > > > > > From: Elaine Meng <meng(a)cgl.ucsf.edu> > > Sent: Wednesday, March 11, 2020 5:22 PM > > To: Tirumalai, Madhan R <mrtirum2(a)Central.UH.EDU> > > Cc: ChimeraX Users Help <chimerax-users(a)cgl.ucsf.edu> > > Subject: Re: [chimerax-users] Making movies and fitting structures into cryoEM > > > > Dear Madhan, > > Although ChimeraX doesn't yet have a movie-making dialog (GUI), you can make movies with ChimeraX command scripts. In a command script (plain text file named ending in .cxc), the "movie" command does recording and creating a movie file, whereas other commands (show/hide, color, turn, 2dlabel, etc.) can be used to control display, motions, and labeling... whatever you want to happen during the movie. Simply opening the .cxc file runs the commands. > > > > You can change volume thresholds with the "volume" command "level" option, for example: > > > > volume #1 level 0.08 > > > > <http://rbvi.ucsf.edu/chimerax/docs/user/commands/volume.html#general> > > > > To gradually change the threshold over multiple display frames, you can combine the "volume" command with the "perframe" command, for example: > > > > perframe "volume #2 level $1" range 0.1,0.3 frames 120; wait 120 > > > > (those should be plain text quotation marks, although the e-mail display may change them to fancy quotation marks) > > > > <http://rbvi.ucsf.edu/chimerax/docs/user/commands/perframe.html> > > > > See ChimeraX "making movies" page and links therein: > > <http://rbvi.ucsf.edu/chimerax/docs/user/movies.html> > > > > ...including movie-making tutorials: > > <http://www.rbvi.ucsf.edu/chimera/data/sbgrid-apr2017/cryomovie.html> > > <http://www.rbvi.ucsf.edu/chimerax/data/movies-may2019/moviemaking.html> > > > > See also general information on ChimeraX command files: > > <http://rbvi.ucsf.edu/chimerax/docs/user/commands/usageconventions.html#cxc-…> > > > > For your other question, if you are asking how to fit an atomic structure into a map, see the "Fit in Map" tool and/or "fitmap" command: > > <http://rbvi.ucsf.edu/chimerax/docs/user/tools/fitmap.html> > > <http://rbvi.ucsf.edu/chimerax/docs/user/commands/fitmap.html> > > > > Or to compare one atomic structure to another atomic structure, you can superimpose them with the "matchmaker" command: > > <http://rbvi.ucsf.edu/chimerax/docs/user/commands/matchmaker.html> > > > > Chimera has a Matchmaker GUI, but ChimeraX does not have the GUI yet, only the command. > > > > I hope this helps, > > Elaine > > ----- > > Elaine C. Meng, Ph.D. > > UCSF Chimera(X) team > > Department of Pharmaceutical Chemistry > > University of California, San Francisco > > > > > >> Begin forwarded message: > > >> > > >> From: "Tirumalai, Madhan R" > > >> Subject: ChimeraX > > >> Date: March 11, 2020 at 1:10:41 PM PDT > > >> To: "goddard(a)cgl.ucsf.edu" <goddard(a)cgl.ucsf.edu> > > >> > > >> Dear Dr. Goddard > > >> > > >> Warm Greetings! > > >> > > >> We have been using ChimeraX to look at mrc files. > > >> > > >> While I am able to use the "Spin movie" option, am not able to use the make movie option, which I could with the Chimera version. > > >> > > >> I would much appreciate if you could kindly let me know how: > > >> > > >> I can use the movie making option to make movies using different images with increasing/ decreasing thresholds (Volume Viewer)? > > >> > > >> Since am not familiar with docking programs, I would like to know how can one a related crystal structure into a new Cryo-EM structure to show the differences between the crystal structure and the Cryo-Em? > > >> > > >> Thanks > > >> Madhan

1 0

VR movie
by Matthias Wolf 13 Mar '20

13 Mar '20

Hi Tom, I really liked your CoV movie https://www.youtube.com/watch?v=dKNbRRRFhqY&feature=youtu.be It’s a new way of storytelling. Although we have used chimeraX in the lab with a Vive and Vive pro for about 2 years, it’s usually one person at a time, with a dark background. But your way opens up interactive VR to a larger audience (even if they don’t get to enjoy the stereoscopic 3D). And it’s cool. I have some questions: 1. How did you overlay the chimera viewport sync’d with the life camera feed showing yourself? Did you use a frame grabber on a different PC to capture the full-screen chimeraX VR viewport while simultaneously recording the camera video stream, e.g. using Adobe Premiere? 2. How did you control flipping out the outer spike domain with your hand controller? I guess you assigned control of a torsional angle in the atomic model to a mouse mode? 3. Did you enable the headset cameras to orient yourself in the room? Thanks for keeping improving chimeraX and VR! Matthias

3 4

Making movies and fitting structures into cryoEM
by Tom Goddard 13 Mar '20

13 Mar '20

> Begin forwarded message: > > From: "Tirumalai, Madhan R" > Subject: ChimeraX > Date: March 11, 2020 at 1:10:41 PM PDT > To: "goddard(a)cgl.ucsf.edu" <goddard(a)cgl.ucsf.edu> > > Dear Dr. Goddard > > Warm Greetings! > > We have been using ChimeraX to look at mrc files. > > While I am able to use the "Spin movie" option, am not able to use the make movie option, which I could with the Chimera version. > > I would much appreciate if you could kindly let me know how: > > I can use the movie making option to make movies using different images with increasing/ decreasing thresholds (Volume Viewer)? > > Since am not familiar with docking programs, I would like to know how can one a related crystal structure into a new Cryo-EM structure to show the differences between the crystal structure and the Cryo-Em? > > Thanks > Madhan > > > Madhan R Tirumalai, Ph.D., > Houston Science Center, #421 > Dept Biology & Biochemistry, University of Houston, 3455, Cullen Blvd, Houston, TX,77204-5001, USA. > Contact nos: 713-632-5463 (Cell); 713-743-8365 (office); 713-743-8351 (Fax) > > email: mrtirum2(a)central.uh.edu <mailto:mrtirum2@central.uh.edu>, madhanrt(a)gmail.com <mailto:madhanrt@gmail.com> > > ORCID link: http://orcid.org/0000-0002-5999-333X <http://orcid.org/0000-0002-5999-333X>

3 3

Re: [chimerax-users] HP Reverb headset
by Tom Goddard 12 Mar '20

12 Mar '20

Hi Shingo, I think Oculus Rift S is the best choice for ChimeraX VR. Unfortunately all the good VR headsets are sold out apparently because of production delays in China the last few months. So you will have to be patient. I think it is worth waiting instead of getting a headset that will not function well. Tom > On Mar 12, 2020, at 5:47 PM, 永野真吾 <snagano(a)tottori-u.ac.jp> wrote: > > Tom, > > Thank you for the very quick response and useful information. I will get Oculus Rift S. > > All the best, > > Shingo > > > > 2020年3月13日(金) 4:01 Tom Goddard <goddard(a)sonic.net <mailto:goddard@sonic.net>>: > Hi Shingo, > > I have not used the HP Reverb VR headset but I have used another Windows Mixed Reality headset, the Samsung Odyssey, which worked fine in ChimeraX. ChimeraX just uses the Windows Mixed Reality runtime through SteamVR so I expect any Windows Mixed Reality headset will work. That said, the reviews on the HP Reverb are poorer than other headsets > > https://www.amazon.com/HP-Reverb-Virtual-Reality-Headset/dp/B07R768KJP <https://www.amazon.com/HP-Reverb-Virtual-Reality-Headset/dp/B07R768KJP> > > I would recommend Oculus Rift S which I have used extensively with ChimeraX. I also have used Vive Pro, Vive, Oculus Rift, and all those work well. > > Tom > > > On Mar 12, 2020, at 3:25 AM, 永野真吾 <snagano(a)tottori-u.ac.jp <mailto:snagano@tottori-u.ac.jp>> wrote: > > > > Hi all, > > > > Has anyone used HP Reverb headset for virtual reality on ChimeraX? > > That headset works fine? > > > > Any comments are welcome. > > > > Best, > > > > Shingo Nagano > > _______________________________________________ > > ChimeraX-users mailing list > > ChimeraX-users(a)cgl.ucsf.edu <mailto:ChimeraX-users@cgl.ucsf.edu> > > Manage subscription: > > http://www.rbvi.ucsf.edu/mailman/listinfo/chimerax-users <http://www.rbvi.ucsf.edu/mailman/listinfo/chimerax-users> > > >

1 0

flatten a cryoEM map
by Hongtao Zhu 12 Mar '20

12 Mar '20

Hi there, Could you show me how to flatten a cryoEM map in chimera just like the attachment? My map has several subunits but with C1 symmetry. Thanks, Hongtao

3 3

ChimeraX does not start after installation
by Lewandowski, Jozef 12 Mar '20

12 Mar '20

Hi, I am trying to get ChimeraX on a Windows 10 installation on a workstation with 4 GPUs (RTX 2080Ti). The program installs just fine but when I start it, it shows the splash screen up to Loading main interface and then quits. I have tried both with the 0.92 release and the daily_build. Any chance you could help with with getting it to work? Browsing archives I learned that this may be down to some incompatibilities with drivers. The onboard graphics is ASPEED Graphics Family with driver version 9.0.10.102 The four Nvidia GeForce RTX2080Ti have driver 26.21.14.4219 installed (I updated to the latest drivers hoping it fixes it - it doesn't). Any ideas or suggestions? Thanks, Józef

2 1

HP Reverb headset
by 永野真吾 12 Mar '20

12 Mar '20

Hi all, Has anyone used HP Reverb headset for virtual reality on ChimeraX? That headset works fine? Any comments are welcome. Best, Shingo Nagano

2 1

Error opening sequence viewer
by Y. Mutum 12 Mar '20

12 Mar '20

Hi I am working with ISOLDE to build my model using ChimeraX interface. There I had added an deleted a few sequences in chain a. This was done while the sequence viewer was closed. Now, when I try to view the sequence by ' sequence chain #1/a', I am getting this error (attached as screenshot) Could you please help? I hope I don't have to start from the begining. Thanks Yaikhomba

3 2

How to save the ChimeraX startup settings?
by Steve Chou 11 Mar '20

11 Mar '20

Dear ChimeraX team, It seems that if the startup window size settings ( display window size, log window width) are different, I get different views after I run the same script, which has a lot of operations, like “move”, “turn”. How to save the startup settings and load them back or is there a startup settings file saved somewhere? Many thanks, Steve Chou -- Steve Chou

2 1

Re: [chimerax-users] pseudobond between atom and center of a ring
by Elaine Meng 10 Mar '20

10 Mar '20

Hi Alexis, I can reproduce the problem with reading the pb file transparency using a color specification of the form: /a:1@c3' /a:1@n3 rgba(20,90,90,70) However, if I use these alternative forms of transparent color specification, it works, i.e. the pseudobond is transparent: /a:1@c3' /a:1@n3 20,90,90,70 - OR - /a:1@c3' /a:1@n3 #00ced155 <http://rbvi.ucsf.edu/chimerax/docs/user/commands/colornames.html> Those atoms are in PDB 1bna, for example. Tested in current daily build I hope this helps, Elaine ----- Elaine C. Meng, Ph.D. UCSF Chimera(X) team Department of Pharmaceutical Chemistry University of California, San Francisco > On Mar 6, 2020, at 10:33 AM, Alexis Rohou <a.rohou(a)gmail.com> wrote: > > Thanks Elaine! > > Great - so now I'm using "measure center" to create markers with 0.0000001 radius at the center of my rings with specified modelId's. Then I have a .pb file that specifies the pseudobonds to draw between markers and atoms. That all seems to work pretty well, thanks! > > Only little snag right now is I can't seem to get transparency working when the color-spec in the .pb file is in the format rgba(). Setting the transparency after opening the pb file using "transparency" works fine though, so I'm not stuck. > > Thanks again for the help. > > Cheers, > Alexis > > On Fri, Mar 6, 2020 at 9:36 AM Elaine Meng <meng(a)cgl.ucsf.edu> wrote: > Here is the more detailed description of pseudobond file format: > > <http://rbvi.ucsf.edu/chimerax/docs/user/pseudobonds.html#pbfiles>

3 7

sessions vs. logging
by Eric Pettersen 09 Mar '20

09 Mar '20

Hi all, As of tomorrow’s daily build, restoring a session will by default clear the log and restore the contents of the log from the session, hidden under a dated disclosure triangle. There is a preference in the “Log” preferences category to not clear the log (but still add the old log under a disclosure triangle). If you are a big fan of the current behavior and don’t want the old log to be added at all, I can add an option for that. If you are, feel free to speak up (but maybe try out the new behavior first?). These dated disclosure triangles “nest”, in that if you do some work and save a session, then later restore that session and do more work and save a second session, when you restore that second session you will see one disclosure triangle that shows the second set of work you did — but at the top of that second set of work will be a disclosure triangle that can be opened to show the first set of work you did. —Eric Eric Pettersen UCSF Computer Graphics Lab

1 0

Re: [chimerax-users] not showing non-traced amino acids in sequence view after splitting a molecule
by Tom Goddard 06 Mar '20

06 Mar '20

Hi Marta, Thanks for the explanation of why you use split. Suppose Model Panel showed each chain, and you deleted all the unwanted chains. Would that work as well as split? Definitely split should preserve the sequence information for missing structure, so we appreciate you bringing that to our attention. Tom > On Mar 6, 2020, at 3:04 AM, Marta Perez Illana <marta.perez(a)cnb.csic.es> wrote: > > > Thanks a lot for the ideas and opening the topic, that was absolutely great and appreciated. I just wanted to make sure that I was not messing around myself with the splitting+sequence thing. > > Ideally I wouldn't use the split as you both suggested... However, I frequently use the match maker with several homology proteins coming from big viruses with lots of proteins... and having less proteins in the session really helps me not to get confused and focus and switching on and of every protein at each time... So I am afraid that I really adore the split command. > > Having the full sequence on the other side helps me out to compare the homology proteins and see which areas are traced in one protein but not in the other (or parts of the protein that are subjected to protease fragmentation and not visualized in the structure) , as well as to get full alignments based on structure... > > I am really grateful for all the help and sorry for being a bit picky on the split+sequence... > > Marta > > > >> On 05.03.20 20:56, Tom Goddard wrote: >> Hi Marta, >> >> The sequence for the missing structure should be preserved by the split command but it currently is not being preserved. We have opened a request for that >> >> https://www.rbvi.ucsf.edu/trac/ChimeraX/ticket/2913 >> >> I agree with Elaine, that you should rarely need to use the split command. >> >> Tom >> >> >>> On Mar 2, 2020, at 9:15 AM, Marta Perez Illana wrote: >>> >>> Hi Elaine >>> >>> Thanks a lot for the quick reply! I though that maybe there was a way to keep that info of the non-traced amino acids after doing splitting. >>> >>> I use split because we work with huge molecules, and therefore is really convenient for focusing on a particular chain. And as well for fitting as you mention... I will try the alternatives you proposed! now knowing that making/saving new models implies for sure kind of "loosing that info"... >>> >>> Regards >>> >>> Marta >>> >>> >>>> On 02/03/2020 18:05, Elaine Meng wrote: >>>> Hi Marta, >>>> When you open a structure from PDB or mmCIF format, there is a special part of the file that gives the full sequence of the structure used in the experiment, even if parts of that structure are not visible in the density (and therefore do not have atomic coordinates). This is part of the model information. >>>> >>>> However, “split” makes new models, and it currently loses various kinds of information. I believe this is the case in both Chimera and ChimeraX. After splitting, it must only look at the coordinates to get the sequence. >>>> >>>> My personal opinion is to avoid using “split” unless it is really necessary. >>>> >>>> In Chimera it sometimes helped with molecular surface calculation, but in ChimeraX there is less reason to do it. You can specify chains individually without splitting. The main reason one might split is for separately fitting the chains. However, if having the full sequence is important, you can instead open multiple copies of the original model and just delete the parts of each that you don’t need. >>>> >>>> I hope this helps, >>>> Elaine >>>> ----- >>>> Elaine C. Meng, Ph.D. >>>> UCSF Chimera(X) team >>>> Department of Pharmaceutical Chemistry >>>> University of California, San Francisco >>>> >>>>> On Mar 2, 2020, at 8:30 AM, Marta Perez Illana wrote: >>>>> >>>>> Hi all >>>>> When I open a cif in chimerax and press the sequence button the window shows up and there is everything within the molecule, including the non-traced amino acids (missing in the structure). >>>>> >>>>> Whereas if I do split the molecule to have just one chain, then the sequence view only shows traced amino acids, but not the non-traced ones anymore... Any ideas on this please? >>>>> >>>>> P.D. With cif files this was a bit confusing in regular chimera for me as well, since when saving the cif it was kind of converted and I guess some info regarding this non-traced aminoacids was missed... >>>>> >>>>> Thank you!!! >>>>> Marta >>> >>> -- >>> Marta Pérez Illana, Ph. D. student >>> Dept. of Macromolecular Structures Lab 15 >>> Centro Nacional de Biotecnología (CNB-CSIC) >>> Darwin, 3 >>> 28049-Madrid (SPAIN) >>> http://wwwuser.cnb.csic.es/~sanmartinlab >>> >>> _______________________________________________ >>> ChimeraX-users mailing list >>> ChimeraX-users(a)cgl.ucsf.edu >>> Manage subscription: >>> http://www.rbvi.ucsf.edu/mailman/listinfo/chimerax-users >> > -- > Marta Pérez Illana, Ph. D. student > Dept. of Macromolecular Structures Lab 15 > Centro Nacional de Biotecnología (CNB-CSIC) > Darwin, 3 > 28049-Madrid (SPAIN) > Email: marta.perez(a)cnb.csic.es > Phone: (0034) 91 585 4508 > http://wwwuser.cnb.csic.es/~sanmartinlab

1 0

pseudobond between atom and center of a ring
by Alexis Rohou 06 Mar '20

06 Mar '20

Hi all, Looking for ideas on how to achieve the following, if possible: I'd like to draw lines to represent favorable ring-ring stacking interactions (lines between the center of two arene rings), ring-ring edge-to-face interactions (between one atom of one ring and the center of the other ring), and between a regular atom (not part of a ring) and the center of an arene ring. So I'm guess what I'm looking for is a way to: 1. compute the center coordinates of a ring 2. place an invisible atom there 3. create a pseudobond between this virtual atom and other atoms/virtual atoms Any suggestions as to how I could achieve this? Cheers, Alexis

3 6

Depth cueing and silhouette
by Aritz Roa Eguiara 05 Mar '20

05 Mar '20

Dear ChimeraX team, I write you to ask about the depth cueing option. I have a structure with the silhouette true option and now I want to change the depth cueing to obtain a slice of the structure but with some of the fog coming from the background. The cartoon color disappear gradually as expected, however the black line of the silhouette is 100% or nothing, is there anything I am doing wrong or is it what I should expect? Is there anyway to obtain also that smooth disappearing of the silhouette? Thank you for your help. All the best, Aritz

4 6

not showing non-traced amino acids in sequence view after splitting a molecule
by Marta Perez Illana 05 Mar '20

05 Mar '20

Hi all When I open a cif in chimerax and press the sequence button the window shows up and there is everything within the molecule, including the non-traced amino acids (missing in the structure). Whereas if I do split the molecule to have just one chain, then the sequence view only shows traced amino acids, but not the non-traced ones anymore... Any ideas on this please? P.D. With cif files this was a bit confusing in regular chimera for me as well, since when saving the cif it was kind of converted and I guess some info regarding this non-traced aminoacids was missed... Thank you!!! Marta

3 4

Secondary structure display - pdb and cif
by Tetter Stephan 04 Mar '20

04 Mar '20

Dear ChimeraX users and developers, I am having an issue with secondary structure display. I am real-space refining a set of 120 chains in phenix. Of these, only 10 are unique, the rest is symmetry-related. Thus, I define secondary structure elements for the 10 unique chains only. The output pdb file header contains the secondary structure elements as imposed during refinement. Displaying this pdb file in ChimeraX shows the right secondary structure. The mmcif file instead, whether I use the phenix output or generate it from the pdb myself, displays different, non-sensical structures. Secondary structure is shown in loop regions, and some actual strands and helices not recognized at all. This artifact is only shown for the 10 subunits with secondary structure definitions, the other subunits show no secondary structure at all, thus something is read in, but not correctly, apparently. Any idea what the problem could be? Could the size of the complex be an issue? The attachments show the lines from the two file types concerning secondary structure definitions. Kind regards, Stephan

3 3

"zone" near MULTIPLE residues in ChimeraX
by Steve Chou 03 Mar '20

03 Mar '20

Dear ChimeraX team, I tried to use the zone command to display the atomic details and DENSITY near THREE residues of interest. These three residues are ligands and bind to the same place. https://www.rbvi.ucsf.edu/chimerax/docs/user/commands/zone.html As the above manual said, the zone command can only display things near ONE residue. Is there a way to work around this? Many thanks, Steve -- Steve Chou

3 3

Bug: selection of atoms by attribute = color
by Pavol Bardy 393791 27 Feb '20

27 Feb '20

Hello, since version 0.91 I am experiencing problems with selecting atoms by color attribute "@@color=color". I am getting an error message "Expected an objects specifier or a keyword". In version 0.90 everything works fine. Other attributes like "bfactor" or "idatm_type" seems to work normally. Kind regards, -- Pavol Bárdy Laboratory of Microbial Molecular Diagnostics Department of Experimental Biology, Masaryk University Kamenice 5 / A25 Brno, 625 00, Czech Republic

2 1

change residues to helix
by Meinan Lyu 24 Feb '20

24 Feb '20

Dear cgl.ucsf.edu, In chimerax, Helix is disrupted for some reason, could I change the intermediate residues into helix? There are two ways I tried, 1: use 'dssp' command, 2: use 'setattr :467-469/A res ss_type 1'. But both didn't not work. Could you tell me how to change this? Best regards, Meinan [image: image.png]

2 2

Default mrc/ccp4 file opening by ChimeraX
by Kim, Doo Nam 20 Feb '20

20 Feb '20

I use mac (10.14.6). But when I double-click mrc/ccp4 file, chimera automatically opens it. I want to open it with ChimeraX (which is faster). However, even when I right-click on ccp4 file -> open with -> always open with -> ChimeraX_Daily, only that specific file is opened with chimera automatically. Does anyone know how to set up so that all (including future) .mrc and .ccp4 files are opened with ChimeraX? Thank you Best, Doonam

2 2

Error in reopening session
by Maximiliane Wieland 20 Feb '20

20 Feb '20

Hi, When I try reopening a session I have been using for two weeks now (so many saved view :( )and I get the following error: Unable to restore session, resetting. Traceback (most recent call last): File "/Applications/ChimeraX_Daily.app/Contents/Library/Frameworks/Python.framework/Versions/3.7/lib/python3.7/site-packages/chimerax/core/session.py", line 653, in restore obj = sm.restore_snapshot(self, data) File "/Applications/ChimeraX_Daily.app/Contents/Library/Frameworks/Python.framework/Versions/3.7/lib/python3.7/site-packages/chimerax/basic_actions/statemgr.py", line 65, in restore_snapshot cmd.name_frozen(session, name, Objects(**value)) File "/Applications/ChimeraX_Daily.app/Contents/Library/Frameworks/Python.framework/Versions/3.7/lib/python3.7/site-packages/chimerax/basic_actions/cmd.py", line 54, in name_frozen raise UserError("nothing is selected by specifier") chimerax.core.errors.UserError: nothing is selected by specifier This is the error from the daily build, in the production release one I get the same error, only difference is in "cmd.py", line 52, in name_frozen When trying to open an older version (that I saved but did not open, since I kept using the same session and saved it to the latest version) I am asked to replace missing files, which are in fact not missing but still in the very same directory and with the very same name, so it feels like the real error lies elsewhere? Can I make it reopen the session without reopening the volume? The last version of the session I can open without a problem is close to two weeks old, I named some selections in the meantime, could that cause such an error? I use ChimeraX on MacOS X 10.12.6 I will also submit the bug but since it is kind of urgent I thought I would try submitting here, too, in hopes of a quick response. Best, Maxi

1 0

Set view
by Aritz Roa Eguiara 19 Feb '20

19 Feb '20

Dear ChimeraX, I am trying to produce a script .cxc to open on ChimeraX and I want to set a specific camera position coordinates that can be opened by anyone. I do obtain the position by just using the command camera, but then I do not know how to obtain that position without saving the view. How should this be written on the command line so that anyone can open it and get that view? For example, I know that PyMol allows the get view command to obtain all the information that later only need to be pasted on the script, is there anything similar? Thank you in advance for your help. Best regards, Aritz

2 2

undo/redo move?
by Oliver Clarke 18 Feb '20

18 Feb '20

Hi, I like the expanded undo/redo capabilities in Chimerax - particularly having the capacity to undo selection/deselection and color commands is very helpful. However it seems like there is no undo/redo move functionality. I find myself using this a lot in Chimera, is there any possibility of incorporating this into Undo/Redo in ChimeraX? Basically adding the possibility to Undo/Redo translation, rotation and scaling? Cheers Oli

4 5

workflow suggestions
by Joel Meyerson 17 Feb '20

17 Feb '20

Hi, I'm a reasonably experienced Chimera user making the shift to ChimeraX. So far I'm really enjoying it. I'm writing because the biggest challenge I'm having so far is that there doesn’t seem to be anything quite like the "activate" features in the original Chimera Model Panel. Are the "activate" features available in ChimeraX, or are there plans to implement them? If not, can you suggest a way to achieve a similar degree of agility for manipulating objects in ChimeraX? So far I have been clicking between Right Mouse modes which does not feel so fluid yet. Perhaps there are keyboard shortcuts or other workflow tricks that you could suggest to improve the feel of navigation. Thanks, Joel

2 1

Re: [chimerax-users] [Chimera-users] Default storage folder, ChimeraX
by Elaine Meng 14 Feb '20

14 Feb '20

Hi Martín, Currently there is no way in the user interface to change the ChimeraX downloads location, described here: <http://rbvi.ucsf.edu/chimerax/docs/user/commands/open.html#fetch> You could make a symbolic link to that location, but the files would still really be in the same place. Probably the location can be changed by editing somewhere in the Python code, but somebody else would have to advise on that. You may be interested that there is a separate mailing list for ChimeraX, chimerax-users(a)cgl.ucsf.edu (CC’d on this message). Best, Elaine ----- Elaine C. Meng, Ph.D. UCSF Chimera(X) team Department of Pharmaceutical Chemistry University of California, San Francisco > On Feb 13, 2020, at 4:00 PM, Martín González Buitrón <martingonzalezbuitron(a)gmail.com> wrote: > > Dears all, > Hope you are well. > > I have started to use ChimeraX in Ubuntu and I realised that one folder was created with my fetches and other things (i.e. ~/Download/ChimeraX/). > > How can I change this to other of my own preference? > All the best, > Martín

3 2

Reverse color byhet
by Ahmad Khalifa 13 Feb '20

13 Feb '20

If I color byhet then color zone a volume, the volume takes some colors from the hetero atom colors. How to reverse byhet coloring? Regards.

3 3

select menu bundle tags
by Anthony James Schaefer 12 Feb '20

12 Feb '20

Hello Are there any plans to add bundle tags for putting selectors on the select menu? Thanks, Tony

3 2

Color by Conservation in ChimeraX
by Sean Moore 11 Feb '20

11 Feb '20

Hello, I read an older post that color by conservation is pending for ChimerX. Is it available now? When I open a sequence alignment that I generated elsewhere, it shows the alignment and conservation, it identified the correct protein chain, but there is no menu in that window to assign the colors to the protein. (no option to "Again from the Multalign Viewer menu, choose: Structure... Render by Conservation. This will call Render by Attribute, in which…”) Should I use Chimera for this instead of ChimeraX? Sean

3 4

Reproduce exact view
by Christophe Leterrier 10 Feb '20

10 Feb '20

Hi, I haven't been able to find how to - log - set - store - recall a precise view (ie get the same exact image if I do a snapshot). First use case would within the same session (fixed computer, window size, no restart of the application in between). Second use case (more tricky?) would be independently of computer / window size / current session. Thanks for your help! Christophe

4 7

Re: [chimerax-users] Crossfade rough transition while making a movie
by Elaine Meng 07 Feb '20

07 Feb '20

Hi Ahmad, This appearance of snapping to the position may not be very avoidable, because “view” transitions just take a linear path and it always looks somewhat abrupt (to me anyway) when it reaches the endpoint. There is currently no option to make it go slower when it is closer to the end. You could try saving an additional position along the way and using it as an intermediate and then going slower after the intermediate by using more frames per distance, and/or you could try adding a few extra wait frames between when it reaches the endpoint and when it starts the crossfade, for example: view pos6 50; wait 100 crossfade 50; view pos5; wait 50 (OR: crossfade 50 viewpos5 50; wait 50) However, I don’t know if either of those would help much. When I’m making a movie I usually end up experimenting a lot with numbers of frames in movements and waits, but the sharp endpoints of view transitions are not currently avoidable as I understand it. Best, Elaine > On Feb 7, 2020, at 1:10 PM, Ahmad Khalifa <underoath006(a)gmail.com> wrote: > > Hi Elaine, > > Sorry if my description was vague. With the modification you suggested, I still have the rough transition between pos6 and pos5 but with a slower crossfade into pos5. > > I attached my movie (made with script in the original post) to get a better idea of what I mean. At 0:2, pos6 appears like it snaps in place, then the crossfade into pos5 occurs. > > Is there a way to make the transition smoother? > > Regards. > > On Fri, Feb 7, 2020 at 12:18 PM Elaine Meng <meng(a)cgl.ucsf.edu> wrote: > Hi Ahmad, > Not sure I understand what you actually want, but I’ll try to answer anyway… > > If you mean you want to see a gradual change in position from pos6 to pos5 then you would need to put a frames number after pos5, for example: > > crossfade 50; view pos5 50; wait 50 > > <http://rbvi.ucsf.edu/chimerax/docs/user/commands/view.html#name> > > (Crossfade does not interpolate the movement, you have to do it with the view command.) > <http://rbvi.ucsf.edu/chimerax/docs/user/commands/crossfade.html> > > Some minor notes on scripts. You do not need “;” at the end of any line; it is only needed to separate commands that are on the same line as each other, as in the example above. > <http://rbvi.ucsf.edu/chimerax/docs/user/commands/usageconventions.html#cxc-…> > > I hope this helps, > Elaine > ----- > Elaine C. Meng, Ph.D. > UCSF Chimera(X) team > Department of Pharmaceutical Chemistry > University of California, San Francisco > > > On Feb 6, 2020, at 11:59 PM, Ahmad Khalifa <underoath006(a)gmail.com> wrote: > > > > I want to crossfade pos6 into pos5, the crossfading itself is smooth, but the below script gives me an abrupt transition at the start of the crossfade (at pos6), how can I fix that?! > > > > view pos4 > > wait 30; > > > > movie record supersample 3 size 1920,1080 > > view pos6 50 > > wait 50; > > crossfade 50; view pos5 > > wait 50; > > movie encode IJ_movie3.mp4 quality high > > <IJ_movie3.mp4>

2 1

Crossfade rough transition while making a movie
by Ahmad Khalifa 07 Feb '20

07 Feb '20

I want to crossfade pos6 into pos5, the crossfading itself is smooth, but the below script gives me an abrupt transition at the start of the crossfade (at pos6), how can I fix that?! view pos4 wait 30; movie record supersample 3 size 1920,1080 view pos6 50 wait 50; crossfade 50; view pos5 wait 50; movie encode IJ_movie3.mp4 quality high

2 1

Command line interface is detached
by Ahmad Khalifa 04 Feb '20

04 Feb '20

My command line interface used to be attached at the bottom. Now it's floating on the screen and the only way I could attach it back is to place it in the right panel. How can I attach it back to the bottom of the screen, spanning the entire length of the ChimeraX window? P.s. I'm running Linux Centos 7.

2 1

Chimerax on a HPC cluster
by Thu Nguyen 31 Jan '20

31 Jan '20

Dear all, I administer a small HPC cluster (Rocks 7) at a bio research institute and a user has requested Chimerax to be installed on it. Has anyone successfully done so ? If yes, I wish to help some hints as to how it is done and an assessment of how it performs . Thanks and regards Thu D. Nguyen Systems & Computational Biology Platform Bio21 Molecular Sciences and Biotechnology Institute, University of Melbourne www.bio21.org

2 1

question about ChimeraX Hide Dust Feature
by Philip Schmiege 29 Jan '20

29 Jan '20

Hi I just downloaded the new ChimeraX, and was wondering where the Hide Dust option is located. I cannot find it. Any help is greatly appreciated! Philip _____________________________________ Philip Schmiege Graduate Student in Biophysics Li Lab, Dept. of Molecular Genetics, L5.162 philip.schmiege(a)utsouthwestern.edu ________________________________ UT Southwestern Medical Center The future of medicine, today.

2 3

Fwd: Colors from snapshots
by Christophe Leterrier 29 Jan '20

29 Jan '20

Hi, I wonder why the colors in the snapshots (and movies) from ChimeraX are always washed-out compared to the colors I get live in the viewer. Attached is a screenshot with the viewer on the left, the corresponding snapshot on the right: one can see how the snapshot is desaturated compared to the viewer. From my limited tests it is the case when saving as both PNG and PPM, and I wonder if this could be corrected. I could saturate the screenshots afterward but it doesn't seem right to me to grossly mess with color levels post-hoc given how stunning the shaded rendering from ChimeraX are. Thanks, Christophe

3 5

Scripting Resources
by llehmann＠uoregon.edu 28 Jan '20

28 Jan '20

Hello, I am a teaching assistant with the University of Oregon for our Structural Biochemistry course. Currently, the course is taught using PyMOL, but we would like to transfer to ChimeraX in the future. A large portion of the course relies on publically available scripts designed for PyMOL that currently do not have equivalents for ChimeraX. We are wondering if there are plans to have a ChimeraX wiki with scripting resources similar to PyMOL at some point, or whether we'd need to write any python scripts ourselves? Of course I understand that ChimeraX is still developing, I'd just like to get a sense of whether we can reasonably transfer the course to ChimeraX in the future. Thank you for your time. Best, Lauren Lehmann Biochemistry Graduate Student University of Oregon

3 4

volume morph
by Karim Rafie 28 Jan '20

28 Jan '20

Dear all, I would like to create a morph movie between two volumes in ChimeraX, however I am having difficulties with generating it. I am using the following command (e.g.) to "create" the morph: volume morph #1,2 frames 50 After it has completed I get a new volume but I can't review the frames themselves, i.e. the output is a new map. I tried scouring the tutorials and command page but can't find a solution. I tried it with the ChimeraX Ubuntu 16.04 distribution as well as the generic linux version. Any help would be greatly appreciated. Best wishes, Karim ############################################## Karim Rafie; PhD, AMRSC Postdoctoral Research Fellow Carlson Lab Department of Medical Biochemistry and Biophysics Umeå University Umeå / Sweden

3 4

interface residue plot save as text file?
by Marta Perez Illana 28 Jan '20

28 Jan '20

Hi alI I have very recently started to play around with ChimeraX. I am trying to use the interface functionality as a substitute of traditional find contacts/clashes ( I am aware of the differences but I think for my purpose are both fine). I would like to save somehow the "interface residue plot", rather than the image of the plot per se, a kind of text file for example... is there a straight fordward way that am I missing? Thanks!! Marta

2 1

SMILES structures
by Eric Pettersen 27 Jan '20

27 Jan '20

Hi all, SMILES strings can now be translated to 3D structures (via NIH NCI or Indiana University web services), e.g. “open smiles:c1ccccc1”. —Eric Eric Pettersen UCSF Computer Graphics Lab

1 1

dome camera mode
by James Hedberg 24 Jan '20

24 Jan '20

Hi, I see from previous threads (3/2019) that there are no plans to add the dome projection/fisheye mode for the camera control on ChimeraX: "It would take some days of work to add dome camera mode to ChimeraX. We have no funding for that and very few people will use it so I'm afraid that is not likely to be implemented.” I understand there is probably not a lot of current demand for this feature, however, in the spirit of Field of Dreams - if you build it, they will come. There is a growing interest in using planetariums/full domes for non-astro related sci-viz, yet very few tools available to do so. We’re currently using Chimera (regular) to do sci-viz in the planetarium for proteins and more. Knowing that this would be supported down the road when ChimeraX takes over (not sure when that will happen) would certainly be nice. You could make ChimeraX uniquely positioned to fill this deficit. Anyway, just a hand raised here for an informal poll of ‘who wants dome mode’. Thanks, James Dr. James Hedberg Physics Lecturer Director, CCNY Planetarium<https://ccnyplanetarium.org> City College of New York Department of Physics

2 6

ChimeraX and REST service interoperation
by Mungo Carstairs (Staff) 24 Jan '20

24 Jan '20

Hi, With your helpful hints, I have a version of Jalview interacting with ChimeraX in the same way it can already with Chimera, over the REST interface. Functionality includes loading structures, aligning, colouring, raising labels on structure on mouseover in Jalview, and exchange of residue features/attributes. I have just one interaction not working yet: highlighting residues in Jalview when a selection is made in ChimeraX. - Jalview starts listening for ChimeraX selections with (e.g.) info notify start selection jalview prefix SelectionChanged url http://localhost:49981/jalview/chimera1 - user makes a selection in ChimeraX - ChimeraX sends GET?chimerax_notification=SelectionChangedselection+changed - Jalview send 'info selection level residue' - no response / timeout; ChimeraX log reports 'broken pipe error' Exception happened during processing of request from ('127.0.0.1', 50714) Traceback (most recent call last): File "/Applications/ChimeraX_Daily.app/.../socketserver.py", line 316, in _handle_request_noblock self.process_request(request, client_address) File "/Applications/ChimeraX_Daily.app/.../socketserver.py", line 347, in process_request self.finish_request(request, client_address) File "/Applications/ChimeraX_Daily.app/.../socketserver.py", line 360, in finish_request self.RequestHandlerClass(request, client_address, self) File "/Applications/ChimeraX_Daily.app/.../socketserver.py", line 720, in __init__ self.handle() File "/Applications/ChimeraX_Daily.app/.../http/server.py", line 426, in handle self.handle_one_request() File "/Applications/ChimeraX_Daily.app/.../http/server.py", line 414, in handle_one_request method() File "/Applications/ChimeraX_Daily.app/.../site-packages/chimerax/rest_server/server.py", line 97, in do_GET self._run(args) File "/Applications/ChimeraX_Daily.app/.../site-packages/chimerax/rest_server/server.py", line 174, in _run self.wfile.write(data) File "/Applications/ChimeraX_Daily.app/.../socketserver.py", line 799, in write self._sock.sendall(b) BrokenPipeError: [Errno 32] Broken pipe NB this is all before a response has been sent to the 'SelectionChanged' message. Any idea what the problem is here please? Do I need to reply to the first message before sending another? The same mechanism does work ok with Chimera. Thanks, Mungo p.s. I noticed the 'listinfo' command (undocumented) seems to behave like 'info'. Should I continue to use 'list' or switch to 'info'? * [University of Dundee shield logo]<http://uod.ac.uk/sig-home> Mungo Carstairs Jalview Computational Scientist The Barton Group Division of Computational Biology School of Life Sciences University of Dundee, Dundee, Scotland, UK www.jalview.org<http://www.jalview.org> www.compbio.dundee.ac.uk<http://www.compbio.dundee.ac.uk> g.m.carstairs(a)dundee.ac.uk<mailto:g.m.carstairs@dundee.ac.uk> [University of Dundee Facebook]<http://uod.ac.uk/sig-fb> [University of Dundee Twitter] <http://uod.ac.uk/sig-tw> [University of Dundee LinkedIn] <http://uod.ac.uk/sig-li> [University of Dundee YouTube] <http://uod.ac.uk/sig-yt> [University of Dundee Instagram] <http://uod.ac.uk/sig-ig> [University of Dundee Snapchat] <http://uod.ac.uk/sig-sc> We're Scottish University of the Year again!<http://uod.ac.uk/sig-strapline> The Times / Sunday Times Good University Guide 2016 and 2017 The University of Dundee is a registered Scottish Charity, No: SC015096

2 3

PubChem
by Eric Pettersen 22 Jan '20

22 Jan '20

Hi all, As of tomorrow’s build, ChimeraX will be able to fetch PubChem entries, e.g. “open pubchem:2519” or “open 2519 from pubchem”. —Eric Eric Pettersen UCSF Computer Graphics Lab

1 0

Next/previous buttons for model display/activation?
by Oliver Clarke 21 Jan '20

21 Jan '20

Hi, I use the Next/Previous buttons in the lower portion of the Chimera GUI all the time for quickly cycling through maps/models (e.g. when inspecting the results of 3D classification). Would it be possible to bring these to the model panel on ChimeraX? Cheers Oli

2 1

Re: [chimerax-users] silhouettes on mesh in ChimeraX
by Tom Goddard 21 Jan '20

21 Jan '20

Hi Gabe, I agree the silhouette edges look bad on meshes. ChimeraX cannot turn off silhouette edges on just meshes. It uses the scene depth at each pixel to compute the edges and the mesh contributes to the scene depth. This is a different method than Chimera used. It has the advantage that it renders basically as fast as without silhouettes where Chimera renders about 2x slower with silhouettes. The Chimera method won't work in ChimeraX because ChimeraX uses modern OpenGL (core profile) which no longer supports drawing linewidth greater than 1. The Chimera algorithm worked by drawing the edges of every triangle in the scene with linewidth 2 and slightly behind the triangle. This linewidth 1 only limitation of modern OpenGL also is a problem with meshes on retina displays where the lines are too thin and hard to see. At any rate, there are ways to provide silhouette edges only on some models but not meshes. But they are hard to implement. I'll make a ticket for it but don't expect to be able to do it with our limited resources. https://plato.cgl.ucsf.edu/trac/ChimeraX/ticket/2765 So the best advice I have is show the atomic model and mesh without silhouettes or use Chimera. Tom Examle of mesh with silhouette edges > On Jan 18, 2020, at 4:01 PM, Gabriel Lander <glander(a)scripps.edu> wrote: > > Hi Tom, > One of the "go-to" representations to demonstrate the quality of a modeled PDB in an EM density is sticks shown in a volume mesh. In Chimera when you turn on silhouettes they would only show around the atoms, but not the mesh. This is not the case in ChimeraX, and renderings with silhouettes and meshes look really messy. Is there a way to specifically turn off silhouettes on meshes but not atoms? > Thanks, > -gabe > >

1 0

How to batch process structures?
by jacky zhao 21 Jan '20

21 Jan '20

Hi everyone, I have tried to use chimeraX yesterday. It is vey cool! I just wonder how to batch process the structures? We will generate more than thousands of structures and will analysis the binding interface. Can I use chimeraX to instantly show the interface interactions one by one? Thank you for your time. Jacky

3 5

Exporting image in 300 DPI
by Hassan Ahmed 21 Jan '20

21 Jan '20

Hello, I wanted to ask if it is possible on ChimeraX to export image with 300 or 150 DPI? I can not find a possible selection tool as the older chimera versions. Is there a certain command or an option to do it? Thank you in advance, Regards, Ahmed -- Ahmed Hassan Institute of Plant Biology Braunschweig University of Technology Spielmannstrasse 7 38106 Braunschweig Germany Tel: +49 - 531 - 391 5885 e-mail: a-a.hassan(a)tu-braunschweig.de

2 1

Tile a vseries
by Sean Connell 17 Jan '20

17 Jan '20

Hello, I was wondering if it is possible to tile multiple volume series such that one can have 2-3 series playing side by side? If so could you suggest the syntax for the tile command I cannot seem to get it right? I have the two vseries loaded as #1 and #2 (and each series has 10 sub volumes). I have tried variations of tile #1,2 columns 2 spacingFactor 1 and get errors like this: Traceback (most recent call last): File "/opt/UCSF/ChimeraX-daily/lib/python3.7/site-packages/chimerax/cmd_line/tool.py", line 258, in execute cmd.run(cmd_text) File "/opt/UCSF/ChimeraX-daily/lib/python3.7/site-packages/chimerax/core/commands/cli.py", line 2837, in run result = ci.function(session, **kw_args) File "/opt/UCSF/ChimeraX-daily/lib/python3.7/site-packages/chimerax/std_commands/tile.py", line 27, in tile spacing = max([m.bounds().radius() for m in models]) * spacing_factor File "/opt/UCSF/ChimeraX-daily/lib/python3.7/site-packages/chimerax/std_commands/tile.py", line 27, in <listcomp> spacing = max([m.bounds().radius() for m in models]) * spacing_factor AttributeError: 'NoneType' object has no attribute 'radius' AttributeError: 'NoneType' object has no attribute 'radius' File "/opt/UCSF/ChimeraX-daily/lib/python3.7/site-packages/chimerax/std_commands/tile.py", line 27, in spacing = max([m.bounds().radius() for m in models]) * spacing_factor Thanks in advance for any suggestions you have. sean

2 1

Save scene like in "Chimera"
by Lau Kelvin 17 Jan '20

17 Jan '20

Hello all, Is there a save scene command like in chimera. I have found the command for positions via “view”. If not, its back to saving many sessions at the moment. Best, Kelvin -- Kelvin Lau https://people.epfl.ch/kelvin.lau Protein production and structure core facility - PTPSP EPFL SV PTECH PTPSP AI 2146 (Bâtiment AI) Station 19 CH-1015 Lausanne Switzerland Email: kelvin.lau(a)epfl.ch<mailto:kelvin.lau@epfl.ch> Phone: +41 21 69 30267<tel:+41%2021%2069%C2%A030267> If unreachable: +41 21 69 34494<tel:+41%2021%2069%C2%A030267>

3 4

Show active site metal and ligand in morph
by Yifan Wang 16 Jan '20

16 Jan '20

Dear chimeraX developer, I am a graduate student from university of Texas at San Antonio. I’m trying to make a movie to compare two of my structures (resting state and substrate bound) using the function “morph”. But there is a problem, I very appreciate if you can help me figure this out. As show in Figure 1, I have two structures superposed. The resting state (nude) contains an active site metal ion coordinated by three residues and 3 water molecules. And the substrate bound (blue) also contains a metal coordinated by the same residues, a remaining water molecule, and a new ligand as my substrate. After I entered command “morph #1,2 frames 60”, I got the result of Figure 2. However, the active site metal ion and the water and substrate are missing. I want to show the active site changes between model 1 and 2. Model #3.1 seems keep the metal coordination bonds but I can’t make it present even with “show”. So my question is how to show the metal and the corresponding ligands in morph? Regards, Yifan Wang [cid:143A130E-412D-4674-AB95-99EA0C21DF44@UTSARR.NET] [cid:90E28A3D-AB8F-402F-A982-8B40682176A1@UTSARR.NET]

2 6

Re: [chimerax-users] [Chimera-users] Chimera X commands
by Elaine Meng 14 Jan '20

14 Jan '20

Hi Drew, You may be interested that there is also a mailing list specifically for ChimeraX questions: <http://www.rbvi.ucsf.edu/mailman/listinfo/chimerax-users> We’re glad you like Chimera! For ChimeraX we wanted to make various command-line improvements such as to make it easier to specify chains, to give several commands more obvious names or make them easier to use, etc. If you download ChimeraX the User Guide is in the Help menu, with the top page being an index of tools and commands that links to their individual pages. We also have a copy of the User Guide at our website: <http://www.rbvi.ucsf.edu/chimerax/docs/user/index.html> The User Guide includes a page on the ChimeraX atomspec syntax and another on how it is different from Chimera’s. <http://www.rbvi.ucsf.edu/chimerax/docs/user/commands/atomspec.html> <http://www.rbvi.ucsf.edu/chimerax/docs/user/commands/atomspec-diffsum.html> I hope this helps, Elaine ----- Elaine C. Meng, Ph.D. UCSF Chimera(X) team Department of Pharmaceutical Chemistry University of California, San Francisco > On Jan 13, 2020, at 9:53 PM, Andrew Waight <waight(a)msg.ucsf.edu> wrote: > > Hello all, > I've been an exclusive Chimera user for over 15 years. I have been scripting a lot in python lately and am super excited to learn that ChimeraX is written in python3. I totally want to import some chimera functions into my programs. Problem is, the ChimeraX command syntax seems all new (i can't even really figure out how to select properly, is there a ChimeraX command index that I am missing and is ChimeraX for me? ChimeraX looks beautiful by the way. Thanks you guys are amazing! > Drew

1 0

Show dashed lines after hiding atoms
by Ahmad Khalifa 09 Jan '20

09 Jan '20

How can I show the dashed lines that signifies an interruption in the structure after I do "Hide model-spec atoms"? Regards.

2 1

Chains with symbol ID such as % and $ cause errors
by Ahmad Khalifa 08 Jan '20

08 Jan '20

I can do "show #2/m cartoons" for a chain with ID m, but for a chain with ID % or $, I get: show #2/% cartoons Expected a collection of one of 'atoms', 'bonds', 'cartoons', 'models', 'pbonds', 'pseudobonds', 'ribbons', or 'surfaces' or a keyword

2 2

Copy/combine function in ChimeraX
by Ahmad Khalifa 07 Jan '20

07 Jan '20

How do I duplicate (back up) a model that I already have open in ChimeraX? Regards.

2 1